| Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001040572.1 | Gene: | Cadm4 / 365216 | RGDID: | 1304722 | Length: | 388 | Species: | Rattus norvegicus |
| Alignment Length: | 283 | Identity: | 65/283 - (22%) |
|---|---|---|---|
| Similarity: | 103/283 - (36%) | Gaps: | 79/283 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 115 NITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKV---------VRTADS 170
Fly 171 KDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKV------GS 229
Fly 230 SVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRI-- 292
Fly 293 ----------ANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAA-MQKSRAIRTSGSMRSSRLV 346
Fly 347 LLLAMVAS---SVVRWLIGGQRI 366 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 26/99 (26%) |
| Ig | 116..192 | CDD:299845 | 21/84 (25%) | ||
| ig | 220..306 | CDD:278476 | 21/103 (20%) | ||
| IG_like | 220..306 | CDD:214653 | 21/103 (20%) | ||
| Cadm4 | NP_001040572.1 | Ig | 29..120 | CDD:416386 | 26/99 (26%) |
| FR1 | 29..45 | CDD:409353 | 5/13 (38%) | ||
| Ig strand A' | 30..36 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 38..46 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 46..51 | CDD:409353 | 0/5 (0%) | ||
| FR2 | 52..59 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 52..58 | CDD:409353 | 2/5 (40%) | ||
| CDR2 | 60..71 | CDD:409353 | 1/10 (10%) | ||
| Ig strand C' | 62..66 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 68..71 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 72..107 | CDD:409353 | 12/44 (27%) | ||
| Ig strand D | 76..83 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 86..92 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 99..107 | CDD:409353 | 4/7 (57%) | ||
| CDR3 | 108..111 | CDD:409353 | 2/2 (100%) | ||
| Ig strand G | 111..120 | CDD:409353 | 1/8 (13%) | ||
| FR4 | 113..120 | CDD:409353 | 1/6 (17%) | ||
| IgI_2_Necl-4 | 121..220 | CDD:409468 | 24/129 (19%) | ||
| Ig strand B | 141..145 | CDD:409468 | 2/3 (67%) | ||
| Ig strand C | 155..159 | CDD:409468 | 0/3 (0%) | ||
| Ig strand E | 182..186 | CDD:409468 | 2/9 (22%) | ||
| Ig strand F | 196..201 | CDD:409468 | 0/4 (0%) | ||
| Ig strand G | 213..216 | CDD:409468 | 0/2 (0%) | ||
| Ig strand A' | 231..235 | CDD:409353 | 2/3 (67%) | ||
| IGc2 | 237..298 | CDD:197706 | 8/33 (24%) | ||
| Ig strand B | 241..248 | CDD:409353 | 4/6 (67%) | ||
| Ig strand C | 255..260 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 262..264 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 274..280 | CDD:409353 | |||
| Ig strand F | 287..294 | CDD:409353 | |||
| Ig strand G | 300..308 | CDD:409353 | |||
| 4.1m | 344..362 | CDD:128590 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 41 | 1.000 | Domainoid score | I12165 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||