| Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038937673.1 | Gene: | Igdcc4 / 363081 | RGDID: | 1310919 | Length: | 1345 | Species: | Rattus norvegicus |
| Alignment Length: | 274 | Identity: | 65/274 - (23%) |
|---|---|---|---|
| Similarity: | 104/274 - (37%) | Gaps: | 52/274 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 109 DFGM-PRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKD 172
Fly 173 WTLHVKYAQPRDSGIYEC--------QVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGS 229
Fly 230 SVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIAN 294
Fly 295 AQLLDTGNYTC---MPTTAEAASVVVNVINDESPAAMQKSRAI-RTSGSMRSSRLVLLLAMVASS 355
Fly 356 VVRWLIGGQRIGSN 369 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 20/100 (20%) |
| Ig | 116..192 | CDD:299845 | 15/83 (18%) | ||
| ig | 220..306 | CDD:278476 | 24/88 (27%) | ||
| IG_like | 220..306 | CDD:214653 | 24/88 (27%) | ||
| Igdcc4 | XP_038937673.1 | Ig | 131..223 | CDD:416386 | |
| Ig strand A' | 135..138 | CDD:409353 | |||
| Ig strand B | 144..154 | CDD:409353 | |||
| Ig strand C | 160..165 | CDD:409353 | |||
| Ig strand C' | 167..169 | CDD:409353 | |||
| Ig strand D | 175..179 | CDD:409353 | |||
| Ig strand E | 182..187 | CDD:409353 | |||
| Ig strand F | 209..217 | CDD:409353 | |||
| Ig_3 | 237..308 | CDD:404760 | 17/84 (20%) | ||
| Ig strand A' | 243..246 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 252..259 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 265..270 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 272..274 | CDD:409353 | 0/10 (0%) | ||
| Ig strand D | 280..284 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 287..292 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 300..308 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 316..324 | CDD:409353 | 2/7 (29%) | ||
| IG_like | 342..423 | CDD:214653 | 27/103 (26%) | ||
| Ig strand A' | 342..347 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 353..360 | CDD:409353 | 3/11 (27%) | ||
| Ig strand C | 366..371 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 373..375 | CDD:409353 | 1/1 (100%) | ||
| Ig strand D | 381..384 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 387..393 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 400..407 | CDD:409353 | 3/6 (50%) | ||
| Ig | 442..514 | CDD:416386 | 7/31 (23%) | ||
| Ig strand B | 443..451 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 457..462 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 464..467 | CDD:409353 | 1/2 (50%) | ||
| Ig strand D | 472..476 | CDD:409353 | |||
| Ig strand E | 478..485 | CDD:409353 | |||
| Ig strand F | 494..501 | CDD:409353 | |||
| Ig strand G | 505..514 | CDD:409353 | |||
| fn3 | 522..607 | CDD:394996 | |||
| FN3 | 619..712 | CDD:238020 | |||
| fn3 | 724..818 | CDD:394996 | |||
| FN3 | 842..934 | CDD:238020 | |||
| FN3 | 942..1034 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||