DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Sdk2

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:435 Identity:97/435 - (22%)
Similarity:142/435 - (32%) Gaps:140/435 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PAVKSLSHLVDGNDNLLPMVSAPSSIDNDYVYIASVNRKFPQFGNSIDDE---------REAEEQ 96
            |.:|  .|:|...|..|        :.|.   |:..||:.......:.|.         |.:...
  Rat   246 PLIK--LHIVWKKDGAL--------LSNG---ISDYNRRLTITNPMVSDAGYYECEAMLRSSSVA 297

  Fly    97 PPEETTY----PPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYT 157
            |.....|    .||.|.....|:||........|.||...:...|::|.  :|..::..|.||  
  Rat   298 PVTRGAYLSVLEPPQFVREPERHITAEMEKVVDIPCRAKGVPPPSITWY--KDAALVEVGKLT-- 358

  Fly   158 SDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQV-NTEPKISMAFRLNVIVTPPDAKAIIAGPT 221
               |||     ...|..|.:....|.|:|:.:|.. |...:...:..|.|....|:   |..||.
  Rat   359 ---RFK-----QRSDGGLQISGLLPDDTGMVQCFAHNAAGEAQTSTYLAVTSIAPN---ITRGPL 412

  Fly   222 DLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKL 286
            |..|..|.||.|.|.     ||......|.|.:|..||.       ..::.|.|.    ||.|  
  Rat   413 DSTVIDGMSVVLACE-----TSGAPRPAITWQKGERILA-------SGSVQLPRF----TLLE-- 459

  Fly   287 QSRLRIANAQLLDTGNYTCMPTTAEA------------------------------ASVVVNVIN 321
            ...|.|:...:.|.|.|||:.|.:..                              ||:|..|.:
  Rat   460 SGSLLISPTHISDAGTYTCLATNSRGVDEASADLVVWARTRITKPPQDQSVIKGTQASMVCGVTH 524

  Fly   322 DE------------SPAAMQKSRAIR--TSGSMRSSRLVLLLAMVASSVVRWLIGGQRIGSNSC- 371
            |.            :..|::.:..||  .:||:..|:             .|  .|. ||:.:| 
  Rat   525 DPRVTVRYVWEKDGATLAVETNPRIRLDRNGSLHISQ-------------TW--SGD-IGTYTCR 573

  Fly   372 ------HDSCSNLSTLHINYCNLRAKITSHLKEHRCLGPGSTVES 410
                  :||         ...:||.:...|..||    |.:|:.:
  Rat   574 VLSAGGNDS---------RNAHLRVRQLPHAPEH----PVATLST 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 23/93 (25%)
Ig 116..192 CDD:299845 20/75 (27%)
ig 220..306 CDD:278476 26/85 (31%)
IG_like 220..306 CDD:214653 26/85 (31%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653
Ig 135..191 CDD:299845
IG_like 225..307 CDD:214653 14/73 (19%)
IGc2 236..289 CDD:197706 11/55 (20%)
I-set 311..400 CDD:254352 25/100 (25%)
Ig 329..397 CDD:143165 19/79 (24%)
I-set 405..495 CDD:254352 31/110 (28%)
Ig 419..495 CDD:299845 25/93 (27%)
Ig 505..589 CDD:299845 19/108 (18%)
IG_like 505..589 CDD:214653 19/108 (18%)
FN3 593..684 CDD:238020 5/17 (29%)
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.