DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dpr19

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:319 Identity:78/319 - (24%)
Similarity:133/319 - (41%) Gaps:89/319 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 FGNSIDDEREAEEQPPEETTYPPPVFDFGMPRN--ITTRTGHTAAINCRVDNLGDKSVSWIRKRD 145
            |||::..:                   |....|  :..:.|..|.:.|.|......:|||||::|
  Fly    34 FGNTLQSQ-------------------FNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKD 79

  Fly   146 LHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTP 210
            ..:||.|:.|::||:||.|..|.....|:|.:|..:..|.|.||||::..|..|:...|.::   
  Fly    80 FQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIV--- 141

  Fly   211 PDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWY----------RGPYILTPFVAH 265
             :|.|.|:...:|::...|::.|.|.:|:   :.::...::||          :|.:::|. :..
  Fly   142 -EAVAEISSAPELHIDETSTLRLECKLKR---ATENPAFVFWYHDSKMINYDSQGGFVVTS-IGQ 201

  Fly   266 PNDAAIDLQRIS----------MEST---------------------------LAEKLQSR---- 289
            .|..:....|.|          |||:                           :.::.||.    
  Fly   202 SNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLN 266

  Fly   290 -----LRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQ-KSRAI---RTSGS 339
                 |.:........|||||.|:.|..||:.|:|:..|..|||| .:|:|   .|:|:
  Fly   267 PSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNGN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 33/94 (35%)
Ig 116..192 CDD:299845 28/75 (37%)
ig 220..306 CDD:278476 22/141 (16%)
IG_like 220..306 CDD:214653 22/141 (16%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 29/76 (38%)
IGc2 55..125 CDD:197706 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.