DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpr2 and VSTM2B

DIOPT Version :9

Sequence 1:	NP_001014480.4	Gene:	dpr2 / 3346227	FlyBaseID:	FBgn0261871	Length:	410	Species:	Drosophila melanogaster
Sequence 2:	NP_001139811.1	Gene:	VSTM2B / 342865	HGNCID:	33595	Length:	285	Species:	Homo sapiens

Alignment Length:	144	Identity:	32/144 - (22%)
Similarity:	58/144 - (40%)	Gaps:	26/144 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   220 PTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAI------------D 272
            |.|:.|:.|..:.:.|..:....::..: .|.|:   |:..|.....::.|:            |
Human    34 PKDVTVREGDDIEMPCAFRASGATSYSL-EIQWW---YLKEPPRELLHELALSVPGARSKVTNKD 94

  Fly   273 LQRISMESTLAEKLQSRLRIANAQLLDTGNYTCM-------PTTAEAASVVVNVINDESPAAMQK 330
            ..:||........:..|||::..:|.|.|.|.|.       .|....|..::.|::..:|..||.
Human    95 ATKISTVRVQGNDISHRLRLSAVRLQDEGVYECRVSDYSDDDTQEHKAQAMLRVLSRFAPPNMQA 159

  Fly   331 SRA---IRTSGSMR 341
            :.|   |::||..|
Human   160 AEAVSHIQSSGPRR 173

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpr2	NP_001014480.4	IG_like	113..206	CDD:214653
		Ig	116..192	CDD:299845
		ig	220..306	CDD:278476	20/97 (21%)
		IG_like	220..306	CDD:214653	20/97 (21%)
VSTM2B	NP_001139811.1	Ig	32..138	CDD:299845	21/107 (20%)
		IG_like	34..139	CDD:214653	22/108 (20%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	161..226		5/13 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910