DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and DIP-iota

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:279 Identity:75/279 - (26%)
Similarity:113/279 - (40%) Gaps:37/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADS 170
            |.|. |...|.|...|..|.:.|.|.:|....|:|:|.....||:......|.:.|..:..| :.
  Fly    31 PKFS-GPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHT-EH 93

  Fly   171 KDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPT--DLYVKVGSSVTL 233
            :.|.|.::..|..|.|.|.||:||:|..|....|:|:| |||   |:...|  |:....|.:|||
  Fly    94 RIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVV-PPD---IVDYQTSQDVVRSTGQNVTL 154

  Fly   234 TCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLL 298
            ||     :.:...:..|.|.|..  .||.:...:.   |.:..|:|.       ..|.:...|..
  Fly   155 TC-----SATGVPMPTITWRREE--ATPILISDDG---DREVFSVEG-------QNLTLWQVQRS 202

  Fly   299 DTGNYTCM------PTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMVASSVV 357
            ..|.|.|:      ||.::...:|||.    :|....:...|.. |..:...|..:.....:||.
  Fly   203 HMGAYLCIASNGVPPTVSKRVMLVVNF----APTIWTRYDTIYV-GLGQKLTLECITESQPASVN 262

  Fly   358 RWLIGGQRIGSNSCHDSCS 376
            .||...|.:...| ::|.|
  Fly   263 FWLRDSQLLQGGS-YESVS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/92 (30%)
Ig 116..192 CDD:299845 21/75 (28%)
ig 220..306 CDD:278476 20/87 (23%)
IG_like 220..306 CDD:214653 20/87 (23%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 27/86 (31%)
Ig 39..122 CDD:299845 26/83 (31%)
Ig 132..213 CDD:299845 25/100 (25%)
IG_like 141..227 CDD:214653 22/102 (22%)
IG_like 239..322 CDD:214653 11/44 (25%)
IGc2 245..313 CDD:197706 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.