DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and DIP-iota

DIOPT Version :10

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:279 Identity:75/279 - (26%)
Similarity:113/279 - (40%) Gaps:37/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADS 170
            |.|. |...|.|...|..|.:.|.|.:|....|:|:|.....||:......|.:.|..:..| :.
  Fly    31 PKFS-GPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHT-EH 93

  Fly   171 KDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPT--DLYVKVGSSVTL 233
            :.|.|.::..|..|.|.|.||:||:|..|....|:|:| |||   |:...|  |:....|.:|||
  Fly    94 RIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVV-PPD---IVDYQTSQDVVRSTGQNVTL 154

  Fly   234 TCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLL 298
            ||     :.:...:..|.|.|..  .||.:...:.   |.:..|:|.       ..|.:...|..
  Fly   155 TC-----SATGVPMPTITWRREE--ATPILISDDG---DREVFSVEG-------QNLTLWQVQRS 202

  Fly   299 DTGNYTCM------PTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMVASSVV 357
            ..|.|.|:      ||.::...:|||.    :|....:...|.. |..:...|..:.....:||.
  Fly   203 HMGAYLCIASNGVPPTVSKRVMLVVNF----APTIWTRYDTIYV-GLGQKLTLECITESQPASVN 262

  Fly   358 RWLIGGQRIGSNSCHDSCS 376
            .||...|.:...| ::|.|
  Fly   263 FWLRDSQLLQGGS-YESVS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/92 (30%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 2/5 (40%)
FR2 137..151 CDD:409355 5/13 (38%)
Ig strand C 137..143 CDD:409355 2/5 (40%)
Ig strand C' 149..153 CDD:409355 1/3 (33%)
CDR2 153..162 CDD:409355 1/8 (13%)
Ig strand D 162..167 CDD:409355 0/4 (0%)
FR3 163..192 CDD:409355 8/28 (29%)
Ig strand E 172..178 CDD:409355 2/5 (40%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 20/87 (23%)
Ig strand B 231..235 CDD:409353 3/3 (100%)
Ig strand C 261..265 CDD:409353 1/3 (33%)
Ig strand E 289..292 CDD:409353 1/2 (50%)
Ig strand F 302..307 CDD:409353 2/10 (20%)
Ig strand G 310..313 CDD:409353 0/2 (0%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 27/86 (31%)
Ig strand B 48..52 CDD:143290 1/3 (33%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 26/113 (23%)
Ig strand B 152..156 CDD:409562 3/3 (100%)
Ig strand C 165..169 CDD:409562 1/3 (33%)
Ig strand E 192..196 CDD:409562 1/3 (33%)
Ig strand F 206..211 CDD:409562 2/4 (50%)
Ig strand G 220..223 CDD:409562 0/2 (0%)
Ig_3 231..310 CDD:464046 12/52 (23%)

Return to query results.
Submit another query.