DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and DIP-theta

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:338 Identity:86/338 - (25%)
Similarity:129/338 - (38%) Gaps:89/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ATPILVIMISISRAW------------------TMQQQHLSPAI---QQHPAVKSLSHLVD--GN 53
            ||..:|.:|.:|.|.                  .|..||....|   ::|..:  ..||.:  ..
  Fly    46 ATAAVVSIICLSLALPGCAAQESDDEGELHHLDQMHHQHQDFIIGESEEHDHI--AHHLAEMQNK 108

  Fly    54 DNLLPMVSAPSSIDNDYVYIASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITT 118
            |.||      ..|..|.|..|...:..|:||..:                          :|:|.
  Fly   109 DELL------EDIREDTVVNAIPEKDLPKFGELL--------------------------QNVTV 141

  Fly   119 RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPR 183
            .....|.:.|.||||....::|:|.....|||......|.:.|..:.. |:.:.|.|.::..:..
  Fly   142 PVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITH-AEKRAWILRIRDVKES 205

  Fly   184 DSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGP--TDLYVKVGSSVTLTCHVKQPATSAQD 246
            |.|.|.||:||:|..|....|:|:| |||   |:..|  ||:.::.||:|||.|     |.:...
  Fly   206 DKGWYMCQINTDPMKSQVGYLDVVV-PPD---ILDYPTSTDMVIREGSNVTLKC-----AATGSP 261

  Fly   247 IGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCM----- 306
            ...|.|.|....|.|.   ||.|    :.::...       |.|.||....|:.|.|.|:     
  Fly   262 TPTITWRREGGELIPL---PNGA----EAVAYNG-------SFLTIAKVNRLNMGAYLCIASNGI 312

  Fly   307 -PTTAEAASVVVN 318
             ||.::...::|:
  Fly   313 PPTVSKRVMLIVH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/92 (30%)
Ig 116..192 CDD:299845 21/75 (28%)
ig 220..306 CDD:278476 25/87 (29%)
IG_like 220..306 CDD:214653 25/87 (29%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 29/93 (31%)
IG_like 137..230 CDD:214653 29/93 (31%)
IG_like 240..324 CDD:214653 27/102 (26%)
IGc2 247..310 CDD:197706 23/81 (28%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.