DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dpr4

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:274 Identity:124/274 - (45%)
Similarity:164/274 - (59%) Gaps:29/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EQPPE--ETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYT 157
            |.||.  ||.|..|.||....|.:|...|..|.::|||.||||::|||||||||||||.||||||
  Fly    32 EVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYT 96

  Fly   158 SDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTD 222
            :|:||:.:.:..|.:|||.:...||||||.|||||:||||||..|||||:|    ::|.|.|..:
  Fly    97 NDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVV----SRAKILGNAE 157

  Fly   223 LYVKVGSSVTLTCHVKQPATSAQDIGP--IYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEK 285
            |::|.||.:.|||...|     ..:.|  ||||:|..::.    :.....|::  |:..||..  
  Fly   158 LFIKSGSDINLTCLAMQ-----SPVPPSFIYWYKGKRVMN----YSQRGGINV--ITERSTRT-- 209

  Fly   286 LQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSR-----L 345
              |:|.||.|...|:|||||.|:::::|||||:|||.|.|||||...:..|.....||.     |
  Fly   210 --SKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVL 272

  Fly   346 VLLLAMVASSVVRW 359
            ...::|..:||. |
  Fly   273 ATWMSMTVASVA-W 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 57/92 (62%)
Ig 116..192 CDD:299845 45/75 (60%)
ig 220..306 CDD:278476 28/87 (32%)
IG_like 220..306 CDD:214653 28/87 (32%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 58/92 (63%)
IG_like 53..145 CDD:214653 57/91 (63%)
ig 153..227 CDD:278476 28/88 (32%)
IG_like 161..>227 CDD:214653 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444735
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.990

Return to query results.
Submit another query.