Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006510497.1 | Gene: | Opcml / 330908 | MGIID: | 97397 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 335 | Identity: | 67/335 - (20%) |
---|---|---|---|
Similarity: | 125/335 - (37%) | Gaps: | 97/335 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 ETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKV 164
Fly 165 VRTADSKDWTLHVKYAQPRDSGIYECQVNTE--PKISMAFRLNVIV-TPPDAKAIIAGPTDLYVK 226
Fly 227 VGSSVTLTC---------------------------------HVKQPATSAQDIGPIYWYRGPYI 258
Fly 259 --------LTPFVAHPNDAAIDLQR---ISMEST---LAE-----------------KLQSRLRI 292
Fly 293 A-----NAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMV 352
Fly 353 ASSVVRWLIG 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 25/94 (27%) |
Ig | 116..192 | CDD:299845 | 18/75 (24%) | ||
ig | 220..306 | CDD:278476 | 24/154 (16%) | ||
IG_like | 220..306 | CDD:214653 | 24/154 (16%) | ||
Opcml | XP_006510497.1 | Ig | 44..132 | CDD:416386 | 25/94 (27%) |
Ig strand A' | 44..49 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 51..59 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 59..63 | CDD:409353 | 1/3 (33%) | ||
FR2 | 64..70 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 64..70 | CDD:409353 | 2/6 (33%) | ||
CDR2 | 71..83 | CDD:409353 | 4/13 (31%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/5 (20%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 6/34 (18%) | ||
Ig strand D | 87..94 | CDD:409353 | 1/7 (14%) | ||
Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 123..132 | CDD:409353 | 4/11 (36%) | ||
FR4 | 125..132 | CDD:409353 | 2/9 (22%) | ||
Ig_3 | 135..206 | CDD:404760 | 13/73 (18%) | ||
Ig strand A | 135..138 | CDD:409353 | 2/2 (100%) | ||
Ig strand A' | 144..148 | CDD:409353 | 1/3 (33%) | ||
Ig strand B | 151..160 | CDD:409353 | 6/8 (75%) | ||
Ig strand C | 165..170 | CDD:409353 | 0/4 (0%) | ||
Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
Ig strand F | 198..206 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 223..300 | CDD:404760 | 14/76 (18%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 1/5 (20%) | ||
Ig strand B | 240..244 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 253..257 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 279..283 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 293..298 | CDD:409353 | 4/4 (100%) | ||
Ig strand G | 306..309 | CDD:409353 | 0/2 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |