DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Opcml

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:335 Identity:67/335 - (20%)
Similarity:125/335 - (37%) Gaps:97/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKV 164
            :.|:|..:      .|:|.|.|.:|.:.|.:|:...: |:|:.:..  ||.||...::.|.|. :
Mouse    35 DATFPKAM------DNVTVRQGESATLRCTIDDRVTR-VAWLNRST--ILYAGNDKWSIDPRV-I 89

  Fly   165 VRTADSKDWTLHVKYAQPRDSGIYECQVNTE--PKISMAFRLNVIV-TPPDAKAIIAGPTDLYVK 226
            :.......:::.::.....|.|.|.|.|.|:  ||.|   |:::|| .||....|   .:|:.|.
Mouse    90 ILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTS---RVHLIVQVPPQIMNI---SSDITVN 148

  Fly   227 VGSSVTLTC---------------------------------HVKQPATSAQDIGPIYWYRGPYI 258
            .||||||.|                                 .:|:..:...:...:.....|.:
Mouse   149 EGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDV 213

  Fly   259 --------LTPFVAHPNDAAIDLQR---ISMEST---LAE-----------------KLQSRLRI 292
                    ..|:::...:..:.:.:   :|.|::   :||                 :::::.||
Mouse   214 RKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRI 278

  Fly   293 A-----NAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMV 352
            :     |....|.|||||:.|.....:.....:.:.||::..........|...:||.:..|   
Mouse   279 STLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSSAVAGPGAVIDGVNSASRALACL--- 340

  Fly   353 ASSVVRWLIG 362
                  ||.|
Mouse   341 ------WLSG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 25/94 (27%)
Ig 116..192 CDD:299845 18/75 (24%)
ig 220..306 CDD:278476 24/154 (16%)
IG_like 220..306 CDD:214653 24/154 (16%)
OpcmlXP_006510497.1 Ig 44..132 CDD:416386 25/94 (27%)
Ig strand A' 44..49 CDD:409353 2/4 (50%)
Ig strand B 51..59 CDD:409353 2/7 (29%)
CDR1 59..63 CDD:409353 1/3 (33%)
FR2 64..70 CDD:409353 2/6 (33%)
Ig strand C 64..70 CDD:409353 2/6 (33%)
CDR2 71..83 CDD:409353 4/13 (31%)
Ig strand C' 72..76 CDD:409353 1/5 (20%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 6/34 (18%)
Ig strand D 87..94 CDD:409353 1/7 (14%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 4/11 (36%)
FR4 125..132 CDD:409353 2/9 (22%)
Ig_3 135..206 CDD:404760 13/73 (18%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 6/8 (75%)
Ig strand C 165..170 CDD:409353 0/4 (0%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 0/7 (0%)
Ig_3 223..300 CDD:404760 14/76 (18%)
putative Ig strand A 224..230 CDD:409353 1/5 (20%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 1/3 (33%)
Ig strand E 279..283 CDD:409353 0/3 (0%)
Ig strand F 293..298 CDD:409353 4/4 (100%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.