DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:176 Identity:50/176 - (28%)
Similarity:80/176 - (45%) Gaps:29/176 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 IDDEREAEEQPPEETTYPPPVFDFGMP-RNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILT 150
            :|.::.|:    |::.:|    .|..| .|:|...|..|.:.|.|:||....|:|:|.....||:
  Fly    61 LDTQQTAQ----EDSDFP----RFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILS 117

  Fly   151 AGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKA 215
            ......:.:.|..:... |.:.|.||:|..:..|.|.|.|||||:|..|....|.|:|.|    .
  Fly   118 IHHNVISQNSRISLTYN-DHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPP----I 177

  Fly   216 IIAGPT--DLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYIL 259
            |:.|.|  |:.|:.|.:::|.|..:             .|..||::
  Fly   178 IVEGLTSNDMVVREGQNISLVCKAR-------------GYPEPYVM 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 31/93 (33%)
Ig 116..192 CDD:299845 22/75 (29%)
ig 220..306 CDD:278476 9/42 (21%)
IG_like 220..306 CDD:214653 9/42 (21%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 30/92 (33%)
IG_like 82..174 CDD:214653 31/92 (34%)
IG_like 184..267 CDD:214653 8/40 (20%)
IGc2 191..255 CDD:197706 6/33 (18%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.