Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100789.2 | Gene: | Unc5d / 306534 | RGDID: | 1309245 | Length: | 956 | Species: | Rattus norvegicus |
Alignment Length: | 215 | Identity: | 42/215 - (19%) |
---|---|---|---|
Similarity: | 70/215 - (32%) | Gaps: | 74/215 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 220 PTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAE 284
Fly 285 KLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLL 349
Fly 350 AMVASSVVRWLIGGQRIG------SNSCHDS--------CSNLSTLHINYCNLRAKI-------- 392
Fly 393 --------TSHLKEHRCLGP 404 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | |
Ig | 116..192 | CDD:299845 | |||
ig | 220..306 | CDD:278476 | 18/85 (21%) | ||
IG_like | 220..306 | CDD:214653 | 18/85 (21%) | ||
Unc5d | NP_001100789.2 | Ig | 51..153 | CDD:299845 | |
Important for interaction with FLRT2. /evidence=ECO:0000269|PubMed:25374360 | 89..91 | ||||
I-set | 159..247 | CDD:254352 | 26/126 (21%) | ||
Ig | 161..247 | CDD:299845 | 26/126 (21%) | ||
TSP1 | 253..304 | CDD:214559 | 11/51 (22%) | ||
TSP1 | 309..357 | CDD:214559 | 4/25 (16%) | ||
ZU5 | 545..640 | CDD:279170 | |||
Death_UNC5D | 856..953 | CDD:176779 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |