DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Unc5d

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001100789.2 Gene:Unc5d / 306534 RGDID:1309245 Length:956 Species:Rattus norvegicus


Alignment Length:215 Identity:42/215 - (19%)
Similarity:70/215 - (32%) Gaps:74/215 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 PTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAE 284
            |....|.:...:.|.|...:...:|:    :.|.:            |:..||.::   :..:..
  Rat   163 PQGREVPIEGMIVLHCRPPEGVPAAE----VEWLK------------NEEPIDSEQ---DENIDT 208

  Fly   285 KLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLL 349
            :....|.|..|:|.|:||||||     ||::|.            |.|::       |:.:|:.:
  Rat   209 RADHNLIIRQARLSDSGNYTCM-----AANIVA------------KRRSL-------SATVVVYV 249

  Fly   350 AMVASSVVRWLIGGQRIG------SNSCHDS--------CSNLSTLHINYCNLRAKI-------- 392
            ....||...|.....|.|      |.:|.:.        |..:|...|. |.....:        
  Rat   250 NGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKIT-CTALCPVDGSWEVWS 313

  Fly   393 --------TSHLKEHRCLGP 404
                    ..||:...|..|
  Rat   314 EWSVCSPECEHLRIRECTAP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653
Ig 116..192 CDD:299845
ig 220..306 CDD:278476 18/85 (21%)
IG_like 220..306 CDD:214653 18/85 (21%)
Unc5dNP_001100789.2 Ig 51..153 CDD:299845
Important for interaction with FLRT2. /evidence=ECO:0000269|PubMed:25374360 89..91
I-set 159..247 CDD:254352 26/126 (21%)
Ig 161..247 CDD:299845 26/126 (21%)
TSP1 253..304 CDD:214559 11/51 (22%)
TSP1 309..357 CDD:214559 4/25 (16%)
ZU5 545..640 CDD:279170
Death_UNC5D 856..953 CDD:176779
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.