DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and SIRPB2

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_005260765.1 Gene:SIRPB2 / 284759 HGNCID:16247 Length:348 Species:Homo sapiens


Alignment Length:330 Identity:73/330 - (22%)
Similarity:117/330 - (35%) Gaps:88/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GHTAAINCR-VDNLGDKSVSWIRKRDLHILTAGILTYTSDER----FK----------VVRTAD- 169
            |.|..:.|. |.:..|..:.|::            ..|.|::    ||          :.||:: 
Human    53 GETLLLRCMVVGSCTDGMIKWVK------------VSTQDQQEIYNFKRGSFPGVMPMIQRTSEP 105

  Fly   170 -SKDWTLHVKYAQPRDSGIYEC------QVNTEPKISMAFRLNVIVT---PPDAKAIIAGPTDLY 224
             :.|:::::.......:|.|.|      ..::|.|....  .:|:|.   .|:....|..|.:|.
Human   106 LNCDYSIYIHNVTREHTGTYHCVRFDGLSEHSEMKSDEG--TSVLV
KGAGDPEPDLWIIQPQELV 168

  Fly   225 V-KVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYI----LTPF--VAHP---------NDAAIDL 273
            : ..|.:|.|.|.|......    |||.|::|..:    :..|  ::||         ||.:|.|
Human   169 LGTTGDTVFLNCTVLGDGPP----GPIRWFQGAGLSREAIYNFGGISHPKETAVQASNNDFSILL 229

  Fly   274 QRISMEST---LAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIR 335
            |.:|.|..   ...|.|   |..|.|.| :|..|.:...|::.|........| ||........|
Human   230 QNVSSEDAGTYYCVKFQ---RKPNRQYL-SGQGTSLKVKAKSTSSKEAEFTSE-PATEMSPTGER 289

  Fly   336 TSGSMRSSRLVLLLAMVASSVVRWLIGGQRIGSNSCHDSCSNLST-----LHINYCNLRAK---- 391
            |.          |..:..|...:..:.|..:|........:||..     ||:| |..|..    
Human   290 TH----------LSGVNESPTGKGAMNGLVMGREQSQTPGANLPPRMLPGLHLN-CRTRTPENHV 343

  Fly   392 ITSHL 396
            ||:.|
Human   344 ITAQL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 18/107 (17%)
Ig 116..192 CDD:299845 16/93 (17%)
ig 220..306 CDD:278476 30/104 (29%)
IG_like 220..306 CDD:214653 30/104 (29%)
SIRPB2XP_005260765.1 V-set 43..149 CDD:284989 19/109 (17%)
IG_like 46..149 CDD:214653 19/109 (17%)
V-set 163..263 CDD:284989 30/107 (28%)
IG_like 168..243 CDD:214653 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.