DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dpr7

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:274 Identity:107/274 - (39%)
Similarity:152/274 - (55%) Gaps:33/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 TTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVV 165
            |....|.||...|||::......|.:.|||.|.|:::|||:|||||||||..|.|||.|:||.|:
  Fly    46 TNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVI 110

  Fly   166 RTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIV--------------TPPDAKAI 216
            ....|:||.|.:.||||||||:|||||||||||::|..|.||.              ....|:|.
  Fly   111 HPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAK 175

  Fly   217 IAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMEST 281
            |.|.|:::||..|::.|.|.|...|.|      :.||.|..:: .|.:.....:::.::..:.:|
  Fly   176 ILGSTEIHVKRDSTIALACSVNIHAPS------VIWYHGSSVV-DFDSLRGGISLETEKTDVGTT 233

  Fly   282 LAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLV 346
                  |||.:..|.|.|:|||||:|..|..|||.|:|:..|.|||||.|.|||...      ..
  Fly   234 ------SRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRA------FT 286

  Fly   347 LLLAMVASSVVRWL 360
            .::.::::.|:.::
  Fly   287 AMITIISTKVLLYI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 54/92 (59%)
Ig 116..192 CDD:299845 41/75 (55%)
ig 220..306 CDD:278476 24/85 (28%)
IG_like 220..306 CDD:214653 24/85 (28%)
dpr7NP_001096850.2 V-set 56..145 CDD:284989 52/88 (59%)
IG_like 58..140 CDD:214653 47/81 (58%)
IG_like 179..265 CDD:214653 31/98 (32%)
Ig 187..257 CDD:299845 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.