DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dpr9

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:349 Identity:117/349 - (33%)
Similarity:169/349 - (48%) Gaps:69/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKS----VSWIRKRD 145
            ||||         .||.....|.||....:|:|...|.||.:||||.|||:|:    |||:|.||
  Fly   244 NSID---------LEEARNAGPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRD 299

  Fly   146 LHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTP 210
            :|:||.|..|||||:||:.:....::||.|.:||.|.||||||||||:|.|.:|....|||:   
  Fly   300 IHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVV--- 361

  Fly   211 PDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQR 275
             :....|.|..|||::.||::.|||.::   .|.:....|:|...    ..|.:||.....|..|
  Fly   362 -EPSTEIIGAPDLYIESGSTINLTCIIQ---NSPEPPAYIFWNHN----NAFPSHPQIINYDSPR 418

  Fly   276 --ISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTS- 337
              :|:.:...:...|.|.|.:|:..|:|:|.|.|:.|:..||.|:|:|..|.:.   ||.:.:| 
  Fly   419 GGVSVVTNKGDTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVSHSV---SRGVPSSN 480

  Fly   338 ---GSMRSSRL-------VLLLAMVASSVVRW---LIG----------------GQRIGSNSCHD 373
               |:..||.|       |.:..::.....||   |:|                |:|.||..|..
  Fly   481 AARGTSASSPLAHSLSVCVPVCVLLQLGACRWIAALLGAALATPPPLRSTRRATGERPGSPGCAP 545

  Fly   374 SCSNLSTLHINYCNLRAKITSHLK 397
            ..          |::|..:.|.|:
  Fly   546 IA----------CDMRHFLASVLR 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 50/96 (52%)
Ig 116..192 CDD:299845 43/79 (54%)
ig 220..306 CDD:278476 24/87 (28%)
IG_like 220..306 CDD:214653 24/87 (28%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 51/97 (53%)
IG_like 263..360 CDD:214653 50/96 (52%)
IG_like 371..464 CDD:214653 30/99 (30%)
IGc2 377..456 CDD:197706 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444729
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.990

Return to query results.
Submit another query.