DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Jaml

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_006510445.4 Gene:Jaml / 270152 MGIID:2685484 Length:405 Species:Mus musculus


Alignment Length:308 Identity:63/308 - (20%)
Similarity:114/308 - (37%) Gaps:89/308 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PPVFDFGMP------RNITTRTGHTAAINCRVDNLGDK---SVSWIRKRDLHILTAGILTYTSD- 159
            |..:..|:|      ..:....|.:..:.|.|....:|   .|.|:..:|....:..:|.|.|: 
Mouse    42 PVGYPQGLPGLTVSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNL 106

  Fly   160 --------ERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAI 216
                    .|..:|......|.:|.::..|..|.|||.|::..:.: ||     |:..|.:...:
Mouse   107 SVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNE-SM-----VMKKPVELWVL 165

  Fly   217 IAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYW----------------------------- 252
            ...|.||.|:||.:..:.|.::  :|..:.:..:.|                             
Mouse   166 PEEPKDLRVRVGDTTQMRCSIQ--STEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLG 228

  Fly   253 -YRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAAS-- 314
             :|....||..::. ||.:|.||.:. ||                  |.|.|||.....:..|  
Mouse   229 RFRNRVDLTGDISR-NDGSIKLQTVK-ES------------------DQGIYTCSIYVGKLESRK 273

  Fly   315 -VVVNVINDE-----SPA-AMQKSRAIRTSGSMRSSRLVLLLAMVASS 355
             :|::|:.||     ||. ...|.:    .|.:..::||:::.:|.::
Mouse   274 TIVLHVVQDEFQRTISPTPPTDKGQ----QGILNGNQLVIIVGIVCAT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 23/110 (21%)
Ig 116..192 CDD:299845 20/87 (23%)
ig 220..306 CDD:278476 23/115 (20%)
IG_like 220..306 CDD:214653 23/115 (20%)
JamlXP_006510445.4 V-set 55..165 CDD:369466 24/115 (21%)
V-set 167..280 CDD:369466 26/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.