DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Lsamp

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:288 Identity:74/288 - (25%)
Similarity:117/288 - (40%) Gaps:50/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EREAEEQPPEETTYPPPVFDFGM-PRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGI 153
            |....::..||...|....||.. ..|||.|.|.||.:.|.|::...| |:|:.:..  |:.||.
Mouse    45 EETMRKKAKEEEGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSK-VAWLNRSG--IIFAGH 106

  Fly   154 LTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNT--EPKISMAFRLNVIVTPPDAKAI 216
            ..::.|.|.::.: ..:.:::|.::.....|.|.|.|.|.|  |||.|..:.  ::..||....|
Mouse   107 DKWSLDPRVELEK-RHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYL--IVQVPPKISNI 168

  Fly   217 IAGPTDLYVKVGSSVTLTCHVK-QPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMES 280
               .:|:.|..||:|||.|... :|.       |:..:|.   |||              :..|.
Mouse   169 ---SSDVTVNEGSNVTLVCMANGRPE-------PVITWRH---LTP--------------LGREF 206

  Fly   281 TLAEKLQSRLRIANAQLLDTGNYTCMP----TTAEAASVVVNVINDESPAAMQKSRAIR-TSGSM 340
            ...|:....|.|...|   :|.|.|..    ::|:...|.|.|   ..|..:.:|::.. |:|  
Mouse   207 EGEEEYLEILGITREQ---SGKYECKAANEVSSADVKQVKVTV---NYPPTITESKSNEATTG-- 263

  Fly   341 RSSRLVLLLAMVASSVVRWLIGGQRIGS 368
            |.:.|....:.|.:....|.....||.|
Mouse   264 RQASLKCEASAVPAPDFEWYRDDTRINS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/94 (30%)
Ig 116..192 CDD:299845 21/75 (28%)
ig 220..306 CDD:278476 21/86 (24%)
IG_like 220..306 CDD:214653 21/86 (24%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 28/95 (29%)
Ig_3 163..232 CDD:372822 24/98 (24%)
Ig_3 250..325 CDD:372822 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.