DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and NEGR1

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:306 Identity:73/306 - (23%)
Similarity:116/306 - (37%) Gaps:68/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 FDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKD 172
            |.:....|:..|.|.||.:.|.::: |....:|:.:..  |:.||...::.|.|.. :.|.:.:|
Human    40 FPWAAVDNMMVRKGDTAVLRCYLED-GASKGAWLNRSS--IIFAGGDKWSVDPRVS-ISTLNKRD 100

  Fly   173 WTLHVKYAQPRDSGIYECQVNTE--PKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTC 235
            ::|.::.....|.|.|.|.|.|:  |: :|...|.|.| ||....|   ..|:.|..|::|||||
Human   101 YSLQIQNVDVTDDGPYTCSVQTQHTPR-TMQVHLTVQV-PPKIYDI---SNDMTVNEGTNVTLTC 160

  Fly   236 HV---KQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQL 297
            ..   .:|:.|.:.|.|        ...||   .|...:|:..|:.:                  
Human   161 LATGKPEPSISWRHISP--------SAKPF---ENGQYLDIYGITRD------------------ 196

  Fly   298 LDTGNYTCMPTTAE---------AASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMVA 353
             ..|.|.|   :||         ...||||.    :|...:......|.|  ||..:....|.|.
Human   197 -QAGEYEC---SAENDVSFPDVRKVKVVVNF----APTIQEIKSGTVTPG--RSGLIRCEGAGVP 251

  Fly   354 SSVVRWLIGGQRIGSNSCHDSCSNLSTLHINYCNLRAKITSHLKEH 399
            .....|..|.:::.:........|.||..|      ..:|:..:||
Human   252 PPAFEWYKGEKKLFNGQQGIIIQNFSTRSI------LTVTNVTQEH 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 25/94 (27%)
Ig 116..192 CDD:299845 19/75 (25%)
ig 220..306 CDD:278476 19/88 (22%)
IG_like 220..306 CDD:214653 19/88 (22%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 25/92 (27%)
IGc2 152..210 CDD:197706 20/90 (22%)
Ig_3 225..301 CDD:372822 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.