DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and CADM2

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens


Alignment Length:196 Identity:53/196 - (27%)
Similarity:81/196 - (41%) Gaps:44/196 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FGMPRNITTRTGHTAAINCRVDNLGDKSVSWIR--KRDLHILTAGILTYTSDERFKVVRTADSKD 172
            |.:.:|:|...|.||.:.||||...:.|:.|..  ::.|:......|   .|.|.::|| |...:
Human    40 FPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKAL---RDNRIELVR-ASWHE 100

  Fly   173 WTLHVKYAQPRDSGIYECQVNTEP-KISMAFRLNVIVTPPDAKAIIAG---PTDLYVKVGSSVTL 233
            .::.|......|.|.|.|.:.|.| |.|.|: |.|:..|  .|..|:|   |    |..|..:.|
Human   101 LSISVSDVSLSDEGQYTCSLFTMPVKTSKAY-LTVLGVP--EKPQISGFSSP----VMEGDLMQL 158

  Fly   234 TCHV--KQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAI-DLQRISMES------TLAEKLQSR 289
            ||..  .:||..      |.|::            ||..| |::.:..|.      |::..|..|
Human   159 TCKTSGSKPAAD------IRWFK------------NDKEIKDVKYLKEEDANRKTFTVSSTLDFR 205

  Fly   290 L 290
            :
Human   206 V 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 29/95 (31%)
Ig 116..192 CDD:299845 22/77 (29%)
ig 220..306 CDD:278476 18/80 (23%)
IG_like 220..306 CDD:214653 18/80 (23%)
CADM2XP_016861551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.