Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016861551.1 | Gene: | CADM2 / 253559 | HGNCID: | 29849 | Length: | 449 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 53/196 - (27%) |
---|---|---|---|
Similarity: | 81/196 - (41%) | Gaps: | 44/196 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 FGMPRNITTRTGHTAAINCRVDNLGDKSVSWIR--KRDLHILTAGILTYTSDERFKVVRTADSKD 172
Fly 173 WTLHVKYAQPRDSGIYECQVNTEP-KISMAFRLNVIVTPPDAKAIIAG---PTDLYVKVGSSVTL 233
Fly 234 TCHV--KQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAI-DLQRISMES------TLAEKLQSR 289
Fly 290 L 290 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 29/95 (31%) |
Ig | 116..192 | CDD:299845 | 22/77 (29%) | ||
ig | 220..306 | CDD:278476 | 18/80 (23%) | ||
IG_like | 220..306 | CDD:214653 | 18/80 (23%) | ||
CADM2 | XP_016861551.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I5236 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |