DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpr2 and zig-10

DIOPT Version :9

Sequence 1:	NP_001014480.4	Gene:	dpr2 / 3346227	FlyBaseID:	FBgn0261871	Length:	410	Species:	Drosophila melanogaster
Sequence 2:	NP_001122644.1	Gene:	zig-10 / 188896	WormBaseID:	WBGene00020800	Length:	322	Species:	Caenorhabditis elegans

Alignment Length:	86	Identity:	25/86 - (29%)
Similarity:	38/86 - (44%)	Gaps:	9/86 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   220 PTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAE 284
            ||:..|.:||:..|.|   :|.||:.    :.|||..:::.....|.|....:.:....|..:.|
Worm    31 PTERLVPIGSTTALEC---EPYTSSN----VTWYRDKHVIATVEGHKNAILNERKPRGGEERIPE 88

  Fly   285 KLQSRLRIANAQLLDTGNYTC 305
              ...|.|.:.|..|.|||.|
Worm    89 --IGFLVIFDVQKEDEGNYYC 107

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpr2	NP_001014480.4	IG_like	113..206	CDD:214653
		Ig	116..192	CDD:299845
		ig	220..306	CDD:278476	25/86 (29%)
		IG_like	220..306	CDD:214653	25/86 (29%)
zig-10	NP_001122644.1	IG_like	31..118	CDD:214653	25/86 (29%)
		IGc2	38..111	CDD:197706	22/79 (28%)
		IG_like	143..215	CDD:214653
		IGc2	145..209	CDD:197706
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23279
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100