Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_938169.2 | Gene: | nitr3d / 171006 | ZFINID: | ZDB-GENE-020225-34 | Length: | 223 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 45/197 - (22%) |
---|---|---|---|
Similarity: | 79/197 - (40%) | Gaps: | 36/197 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 KVGSSVTLTC-HVKQPATSAQDIGPIYWYRGPYILTP-FVAH--PNDAAIDLQRISMES-----T 281
Fly 282 LAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVI--NDESPAAMQKSRAIRTSGSMRSSR 344
Fly 345 LVLLLAMVASSVVRWLIGGQRIGSNSCHDSCS--------NLSTLHINYCNLR-AKITSHLKEHR 400
Fly 401 CL 402 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | |
Ig | 116..192 | CDD:299845 | |||
ig | 220..306 | CDD:278476 | 25/88 (28%) | ||
IG_like | 220..306 | CDD:214653 | 25/88 (28%) | ||
nitr3d | NP_938169.2 | V-set | 26..130 | CDD:311561 | 28/110 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1457433at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |