DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr3d

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_938169.2 Gene:nitr3d / 171006 ZFINID:ZDB-GENE-020225-34 Length:223 Species:Danio rerio


Alignment Length:197 Identity:45/197 - (22%)
Similarity:79/197 - (40%) Gaps:36/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 KVGSSVTLTC-HVKQPATSAQDIGPIYWYRGPYILTP-FVAH--PNDAAIDLQRISMES-----T 281
            ::||||||.| |      |...|..|.||:......| .:||  ||...:..|.....:     |
Zfish    33 ELGSSVTLPCFH------SDDFITTISWYKHSAGKKPLLIAHSAPNSGRVTYQNAFNNTNRFFIT 91

  Fly   282 LAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVI--NDESPAAMQKSRAIRTSGSMRSSR 344
            :|.. ...|.|.:.:..|...|.|       |...:|::  .:.:.....::..|.|..|...|.
Zfish    92 IASG-SYNLSILHLEKEDFATYYC-------AKFFLNIMMFGEGTILLHNETNIIITPESSFWSP 148

  Fly   345 LVLLLAMVASSVVRWLIGGQRIGSNSCHDSCS--------NLSTLHINYCNLR-AKITSHLKEHR 400
            :||:|:::  |.:..::....:....|.:..|        .:.|.:.||..|: :.:|:..:|..
Zfish   149 VVLILSVI--SAISIIVNIFLMICTYCKEDASEQILSRVIQVDTNYFNYVALQSSSVTTSQEETI 211

  Fly   401 CL 402
            |:
Zfish   212 CV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653
Ig 116..192 CDD:299845
ig 220..306 CDD:278476 25/88 (28%)
IG_like 220..306 CDD:214653 25/88 (28%)
nitr3dNP_938169.2 V-set 26..130 CDD:311561 28/110 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.