DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr1m

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_021333060.1 Gene:nitr1m / 170971 ZFINID:ZDB-GENE-020225-5 Length:326 Species:Danio rerio


Alignment Length:212 Identity:50/212 - (23%)
Similarity:80/212 - (37%) Gaps:39/212 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MISISRAWTMQQ------QHLSPAIQQHPAVKSLSH------LVDGNDNLLPMVSAPSSIDNDYV 71
            ::..::||..|.      |.:|..:.|.|...:.|.      ..||..||..:.:.||.....|.
Zfish    44 LLQATKAWFKQTADGKSLQIVSLYLDQIPNWNNNSENGFNIMKEDGYFNLTILKTKPSDSATYYC 108

  Fly    72 YIASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRV---DNL 133
            .|::........|..:.....|:::   .||....:.|       |...|.:..:.|.:   ...
Zfish   109 VISTAYNIGMGSGTRLFVRDSAKDR---NTTLHQSLID-------TVDPGDSVNLQCSIFTESCA 163

  Fly   134 GDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKD-------WTLHVKYAQPRDSGIYECQ 191
            ||.||.|.::....  :.|:| ||..||..  |..||.:       ::||.......|||||.|.
Zfish   164 GDHSVYWFKQSSGD--SEGVL-YTKGERNG--RCKDSTESQTQSCVYSLHKNNISRSDSGIYYCA 223

  Fly   192 VNT--EPKISMAFRLNV 206
            |.:  |..:....:||:
Zfish   224 VASCGEILLGRGTQLNI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/104 (27%)
Ig 116..192 CDD:299845 25/85 (29%)
ig 220..306 CDD:278476
IG_like 220..306 CDD:214653
nitr1mXP_021333060.1 V-set 29..127 CDD:311561 17/82 (21%)
V-set 144..241 CDD:311561 29/102 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.