DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and AgaP_AGAP006274

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_316339.4 Gene:AgaP_AGAP006274 / 1276929 VectorBaseID:AGAP006274 Length:161 Species:Anopheles gambiae


Alignment Length:156 Identity:52/156 - (33%)
Similarity:81/156 - (51%) Gaps:26/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 ISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPF 262
            ||....|.|:|    .:|.|.|..:|:|.:||::.|.|.:::   |.|....:||.|        
Mosquito     8 ISHFVNLQVVV----PEAFILGSGELHVDMGSTINLVCIIEK---SPQPPQYVYWQR-------- 57

  Fly   263 VAHPNDAAI---DLQR-ISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDE 323
                ||..|   |.:| |::|:|...:.||||.|...|:.|:|||||..:..|.||:.|.|...:
Mosquito    58 ----NDRMINYDDSRRDITIETTPGPRTQSRLIIREPQINDSGNYTCSASNTEPASIYVFVSKGD 118

  Fly   324 SPAAMQKSRAIRTSGSMRSSRLVLLL 349
            :.||:.:.   :|||:..:|:|..:|
Mosquito   119 NTAAISRR---KTSGAAATSQLSAIL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 3/7 (43%)
Ig 116..192 CDD:299845
ig 220..306 CDD:278476 30/89 (34%)
IG_like 220..306 CDD:214653 30/89 (34%)
AgaP_AGAP006274XP_316339.4 IG_like 26..105 CDD:214653 31/93 (33%)
Ig 37..104 CDD:143165 27/81 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.