DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and AgaP_AGAP004915

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_315006.4 Gene:AgaP_AGAP004915 / 1275796 VectorBaseID:AGAP004915 Length:458 Species:Anopheles gambiae


Alignment Length:236 Identity:64/236 - (27%)
Similarity:97/236 - (41%) Gaps:51/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 EETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFK 163
            :|..:..|:      .|:|...|..|.:.|.|::||...|:||     ||....|||.......:
Mosquito    42 DEPRFAQPI------PNVTVAVGRDANLPCVVEHLGTYKVAWI-----HIDRQMILTIHRHVISR 95

  Fly   164 VVRTA----DSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLY 224
            :.|.:    :|..|.|||..||..|.|.|.|||||.|.||....|.|:| ||:...|.:.|:.:.
Mosquito    96 IPRYSVTYDNSNTWLLHVSQAQQDDRGYYMCQVNTNPMISQVGYLQVVV-PPNILDIESTPSSVA 159

  Fly   225 VKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSR 289
            |:...::.:||......|.     .|.|.|.                |.|.|::|.      :.:
Mosquito   160 VRENQNINMTCRADGFPTP-----KIIWRRE----------------DGQSITVER------KKK 197

  Fly   290 LRIANAQLL--------DTGNYTCMPTTAEAASVVVNVIND 322
            :.:.:.::|        :.|.|.|:.|.....||...:|.|
Mosquito   198 VMVYDGEVLHLTKVSRNEMGAYLCIATNGVPPSVSKRIILD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 36/96 (38%)
Ig 116..192 CDD:299845 27/79 (34%)
ig 220..306 CDD:278476 15/93 (16%)
IG_like 220..306 CDD:214653 15/93 (16%)
AgaP_AGAP004915XP_315006.4 IG_like 51..144 CDD:214653 37/97 (38%)
Ig 53..144 CDD:299845 36/95 (38%)
Ig 145..225 CDD:299845 19/106 (18%)
I-set 151..239 CDD:254352 22/115 (19%)
IG_like 259..335 CDD:214653
Ig 260..333 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.