DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and AgaP_AGAP005028

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_313891.4 Gene:AgaP_AGAP005028 / 1274863 VectorBaseID:AGAP005028 Length:115 Species:Anopheles gambiae


Alignment Length:120 Identity:40/120 - (33%)
Similarity:59/120 - (49%) Gaps:15/120 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 AKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRIS 277
            |:|.|.||...|:...|::.|.|.|.| :|.|...  |:||....::.          .||.|..
Mosquito     9 ARAEIVGPQVKYLTPDSTLKLICRVVQ-STEASAF--IFWYHNNRMIN----------YDLDRGI 60

  Fly   278 MESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSR 332
            ..||.|:...|.|.|:.|....:|||||:|:.::.|||||::...:.|  :|..|
Mosquito    61 NVSTEADFHYSELTISQASKEHSGNYTCVPSNSQPASVVVHIFKGKVP--LQAGR 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653
Ig 116..192 CDD:299845
ig 220..306 CDD:278476 26/85 (31%)
IG_like 220..306 CDD:214653 26/85 (31%)
AgaP_AGAP005028XP_313891.4 IG_like 16..100 CDD:214653 31/96 (32%)
IGc2 23..93 CDD:197706 26/82 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.