DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and AgaP_AGAP002336

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_312632.5 Gene:AgaP_AGAP002336 / 1273631 VectorBaseID:AGAP002336 Length:901 Species:Anopheles gambiae


Alignment Length:99 Identity:25/99 - (25%)
Similarity:37/99 - (37%) Gaps:26/99 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DFGMPRNITTR------TGHTAAINCRVDNLGDKSVSWI-RKRDLHILTAGILTYTSDERFKV-- 164
            ||..|..|...      .|..|...|:|..|....:.|: :||...         ..|:|.:|  
Mosquito   290 DFACPPAIVENRMQFPGAGENATFICKVTGLPLPKIDWLFQKRSFS---------RHDQRLRVTE 345

  Fly   165 -VRTADSKDWT------LHVKYAQPRDSGIYECQ 191
             |||: .:|.:      |.:...:|.|.|.|.|:
Mosquito   346 AVRTS-PRDQSEVLVSELTIVGVRPSDRGTYVCK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 23/95 (24%)
Ig 116..192 CDD:299845 22/92 (24%)
ig 220..306 CDD:278476
IG_like 220..306 CDD:214653
AgaP_AGAP002336XP_312632.5 LRR_RI <88..263 CDD:238064
leucine-rich repeat 91..116 CDD:275380
LRR_8 115..175 CDD:290566
leucine-rich repeat 117..140 CDD:275380
leucine-rich repeat 141..164 CDD:275380
leucine-rich repeat 165..188 CDD:275380
LRR_8 189..246 CDD:290566
leucine-rich repeat 189..212 CDD:275380
leucine-rich repeat 213..236 CDD:275380
TPKR_C2 245..294 CDD:301599 2/3 (67%)
Ig 295..394 CDD:299845 22/94 (23%)
IG_like 307..389 CDD:214653 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.