DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and AgaP_AGAP010742

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_311455.4 Gene:AgaP_AGAP010742 / 1272555 VectorBaseID:AGAP010742 Length:1195 Species:Anopheles gambiae


Alignment Length:218 Identity:51/218 - (23%)
Similarity:84/218 - (38%) Gaps:60/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSD-------------ERFK 163
            :||::....|..|.:.|.:.||                 .|.:.:|.|             .|:.
Mosquito    13 VPRDLQVLEGTEALLRCEIYNL-----------------VGAVQWTKDGFALGFSHTIPGYPRYS 60

  Fly   164 VVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLN---VIVTPPDAKAIIAGPTDLYV 225
            |:...:...:.|.:..|...|...|:|||. ..|.:.|.|.|   .:::||.:..|.....:..|
Mosquito    61 VLADRNLGIYNLRISNASIEDDAEYQCQVG-PAKFNSAIRANARLTVISPPSSIEIQGHSRNAKV 124

  Fly   226 KV--GSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAE---- 284
            :|  |..:||||.|    ::|:.:..|.||||.      ..:.:|        ::|:.:.|    
Mosquito   125 EVREGQDLTLTCVV----SNAKPVAQIVWYRGK------TEYKSD--------TIENKVTETEGK 171

  Fly   285 --KLQSRLRIANAQLLDTGNYTC 305
              .:.|:|||......|...|||
Mosquito   172 RYTVSSQLRIKPTSDDDYMEYTC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 23/108 (21%)
Ig 116..192 CDD:299845 15/88 (17%)
ig 220..306 CDD:278476 25/94 (27%)
IG_like 220..306 CDD:214653 25/94 (27%)
AgaP_AGAP010742XP_311455.4 Ig 12..106 CDD:299845 23/110 (21%)
IG_like 14..106 CDD:214653 23/109 (21%)
IG_like 124..197 CDD:214653 25/89 (28%)
Ig 133..215 CDD:299845 22/80 (28%)
Ig 221..297 CDD:299845
I-set 419..509 CDD:254352
Ig 438..509 CDD:299845
Ig 530..599 CDD:299845
IG_like 531..610 CDD:214653
IG_like 623..704 CDD:214653
IGc2 628..694 CDD:197706
IG_like 714..798 CDD:214653
Ig 725..786 CDD:299845
Ig 798..905 CDD:299845
I-set 802..900 CDD:254352
FN3 904..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.