DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and Dscaml1

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001074739.2 Gene:Dscaml1 / 114873 MGIID:2150309 Length:2053 Species:Mus musculus


Alignment Length:420 Identity:97/420 - (23%)
Similarity:156/420 - (37%) Gaps:109/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AIQQHPAVKSLSH------LVDGNDNLLPMVSAPSSIDNDYVYIASVNRKFPQFGNSIDDEREAE 94
            |:...|.|:..||      :.||.......|:.|...|.. ||..:..       ||:.   .||
Mouse   442 ALDDEPVVRDGSHRTNQYTMSDGTTISHMNVTGPQIRDGG-VYRCTAR-------NSVG---SAE 495

  Fly    95 EQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSD 159
            .|.......||.:   ...||||...|....|||||......|:.|.  :|..:|        .|
Mouse   496 YQARINVRGPPSI---RAMRNITAVAGRDTLINCRVIGYPYYSIKWY--KDALLL--------PD 547

  Fly   160 ERFKVVRTADSKDWTLHVKYAQP-RDSGIYECQVNTEPKISMAFRLNVIV-TPPDAKAIIAGPTD 222
            ...:||    .::.||.:...|. .|.|.|.|.|..:|::|::..::|.| .||..:.....|  
Mouse   548 NHRQVV----FENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFEFPP-- 606

  Fly   223 LYVKVGSSVTLTCHVKQPATSAQDIGP--IYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEK 285
              ..:|..:.:.|.|     |:.|: |  |.|.:...::           |....:::||   ::
Mouse   607 --ASIGQLLYIPCVV-----SSGDM-PIRITWRKDGQVI-----------ISGSGVTIES---KE 649

  Fly   286 LQSRLRIANAQLLDTGNYTCMPTTAEAASV-----------------------------VVNVIN 321
            ..|.|:|::..|...|||||:.:.| ||:|                             |:|...
Mouse   650 FMSSLQISSVSLKHNGNYTCIASNA-AATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSV 713

  Fly   322 DESPAAMQKSRAIRTSGSMRSSRLVLLLAMV-----ASSVVRWLIGGQRIGSNSCHDS---CSNL 378
            |..|......:..:.||:.:....|.|...:     :|.::|.:: .:.||...|..|   .:::
Mouse   714 DGYPPPKVMWKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVL-EEDIGYYLCQASNGVGTDI 777

  Fly   379 STLHINYCNLRAKITSHLKEHRCLGPGSTV 408
            |........:.|.||||        |.:|:
Mouse   778 SKAMFLTVKIPAMITSH--------PNTTI 799

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 27/93 (29%)
Ig 116..192 CDD:299845 22/76 (29%)
ig 220..306 CDD:278476 20/87 (23%)
IG_like 220..306 CDD:214653 20/87 (23%)
Dscaml1NP_001074739.2 IGc2 43..110 CDD:197706
Ig 125..218 CDD:353325
I-set 226..311 CDD:336764
Ig_3 317..389 CDD:339005
Ig 408..498 CDD:353325 16/66 (24%)
IGc2 519..577 CDD:197706 20/71 (28%)
Ig 615..681 CDD:319273 23/86 (27%)
Ig_DSCAM 707..785 CDD:143211 15/78 (19%)
Ig 803..891 CDD:353325
FN3 887..981 CDD:238020
FN3 988..1085 CDD:238020
FN3 1093..1186 CDD:238020
FN3 1191..1282 CDD:238020
Ig 1307..1377 CDD:319273
FN3 1384..1474 CDD:238020
FN3 1488..1560 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1716..1741
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1773..1803
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1840..1862
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1974..2053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.