DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and LOC101885194

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_009301267.1 Gene:LOC101885194 / 101885194 -ID:- Length:187 Species:Danio rerio


Alignment Length:125 Identity:27/125 - (21%)
Similarity:43/125 - (34%) Gaps:22/125 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKD--WTLHVKYAQPRDSGIYECQVNTEP 196
            |.:..||..|            :.:..||    .||..|  :.|.:......||..|.|.|::..
Zfish    69 GSQKPSWNPK------------FENTNRF----NADKGDNFFNLTILKTTLSDSATYYCVVSSYQ 117

  Fly   197 KISM--AFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYR 254
            ...:  ..||.|..:..|....:.......|..|.||.|.|.:...:.:...  .:||::
Zfish   118 ATGLVSGTRLLVR
DSATDRNTTLHQSLIDSVDPGDSVNLQCSIFTESCAGDH--SVYWFK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 17/75 (23%)
Ig 116..192 CDD:299845 14/59 (24%)
ig 220..306 CDD:278476 8/35 (23%)
IG_like 220..306 CDD:214653 8/35 (23%)
LOC101885194XP_009301267.1 V-set 30..130 CDD:284989 17/76 (22%)
IG_like 30..129 CDD:214653 17/75 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.