DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and LOC101885129

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_021333804.1 Gene:LOC101885129 / 101885129 -ID:- Length:654 Species:Danio rerio


Alignment Length:205 Identity:44/205 - (21%)
Similarity:65/205 - (31%) Gaps:71/205 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 FGNSID-------------DEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLG 134
            ||||.|             .||.|.|.|.|:                         :.|.:.:..
Zfish   138 FGNSTDLIVKAGGVNIESEHERSASESPSED-------------------------LQCSIISQS 177

  Fly   135 ---DKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLH-VKYAQPR---DSGIYECQV 192
               :..|.|.|:|... ...|:: ||.|.|......:...:.|.| ..|:.|:   |..||.|.|
Zfish   178 CAEEHRVYWFRQRSGE-SPPGVI-YTQDSRSAQCENSSDPNSTAHKCIYSLPKTDEDPAIYYCAV 240

  Fly   193 NTEPKISMAFRLNVIVTPPDAKAIIAGP-------TDLY------VKVGSSVTLTCHVKQPATSA 244
            ..         ...|:.....|..:.||       |.|:      |..|.||.|.|.:...:.:.
Zfish   241 AA---------CGQILFGDGRKFCLRGPDSATDRNTTLHQSLIDSVDPGDSVNLQCSIFTESCAG 296

  Fly   245 QDIGPIYWYR 254
            ..  .:||::
Zfish   297 DH--SVYWFK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 19/99 (19%)
Ig 116..192 CDD:299845 18/82 (22%)
ig 220..306 CDD:278476 11/48 (23%)
IG_like 220..306 CDD:214653 11/48 (23%)
LOC101885129XP_021333804.1 Ig 47..146 CDD:325142 5/7 (71%)
Ig 161..253 CDD:325142 24/127 (19%)
V-set 354..454 CDD:311561
V-set 470..566 CDD:311561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.