DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and LOC101883331

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_005161702.1 Gene:LOC101883331 / 101883331 -ID:- Length:279 Species:Danio rerio


Alignment Length:224 Identity:56/224 - (25%)
Similarity:92/224 - (41%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 DLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVT 209
            ||..:.|.:.....||||:.....|.:..:|.:......|.|.|:.|:......|:.. .|:|| 
Zfish    59 DLSFICADVQCEDGDERFRNRLKLDHQTGSLTITNTTFTDEGDYQLQIIGSSSNSVKI-FNIIV- 121

  Fly   210 PPDAK-AIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDL 273
             .||. |.........||.|.||||.|.:|.|       ..:.||....::....   .|.:...
Zfish   122 -HDASTADSEEKKSKSVKEGESVTLNCQIKNP-------NDVKWYFNDLVIAEIT---GDQSKTC 175

  Fly   274 QRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAI---- 334
            :.:..|.. .|:.:.||::.:    ..|:.|.:.|.:..|.|....||..| .::|::.:|    
Zfish   176 RGVRCEDG-DERFRDRLKLDH----QNGSLTIINTKSTDAGVYKLQINSSS-FSIQRNHSISIIS 234

  Fly   335 RTSGSMRSSRLVLLLAM-VASSVVRWLIG 362
            ..|.|:....|.|.:|: :..::|..|||
Zfish   235 EESFSVTDWTLYLCVAIGILVAIVLMLIG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 14/60 (23%)
Ig 116..192 CDD:299845 12/46 (26%)
ig 220..306 CDD:278476 19/85 (22%)
IG_like 220..306 CDD:214653 19/85 (22%)
LOC101883331XP_005161702.1 IG_like 21..121 CDD:214653 15/62 (24%)
Ig 27..122 CDD:299845 17/65 (26%)
IG_like 133..232 CDD:214653 27/114 (24%)
Ig 140..233 CDD:299845 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.