DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and LOC100909964

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_008767726.1 Gene:LOC100909964 / 100909964 RGDID:6500592 Length:308 Species:Rattus norvegicus


Alignment Length:296 Identity:61/296 - (20%)
Similarity:100/296 - (33%) Gaps:101/296 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ITTRTGHTAAINCRVDNLGDKS-VSWIR----KRDLHILTAGILTYTSDERFKVVRTAD-----S 170
            ::...|.:..:||.|.:|.... ..|.:    .|.|      |.::..|...::...||     :
  Rat    40 VSVYDGGSVILNCTVTSLTPVGPTRWFKGEGQNRQL------IYSFRGDYFPRITNIADVTKRNN 98

  Fly   171 KDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYV--------KV 227
            .|:::.:......|:|.|.|         :.|:...:  .||.:....|.|:|:|        ||
  Rat    99 TDFSIRISNIMLADAGTYYC---------VKFQKGTV--EPDIEIQSGGGTELFV
YGADMKKLKV 152

  Fly   228 -----------GSSVTLTCHVKQPATSAQDIGPIYWYRGP----YILTPFVA--HPNDAAIDLQR 275
                       |.||||.|.|    ||...:|||.|:||.    :::..|..  .|....:.   
  Rat   153 VQPEKLISVDAGESVTLNCTV----TSIIPMGPIKWFRGAQHSRHLIFNFTGGYFPRVTNVS--- 210

  Fly   276 ISMESTLAEKLQSRLRIANAQLLDTGNYTCM-------------------------PTTAEAASV 315
               :|:....|...:||:|....|.|.|.|:                         |.|:..|.:
  Rat   211 ---DSSKRNNLDFSIRISNVMPADAGTYYCVKFQKELLETDIEIQSGGGTELLVFEPKTSGIAKI 272

  Fly   316 V--------------VNVINDESPAAMQKSRAIRTS 337
            :              :.:..||.|........|||:
  Rat   273 LAAALLGYKLMLRISMEIDLDEKPLKTAHKDTIRTT 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 18/99 (18%)
Ig 116..192 CDD:299845 17/85 (20%)
ig 220..306 CDD:278476 30/110 (27%)
IG_like 220..306 CDD:214653 30/110 (27%)
LOC100909964XP_008767726.1 V-set 35..142 CDD:284989 23/118 (19%)
IG_like 40..142 CDD:214653 23/118 (19%)
V-set 154..261 CDD:284989 26/116 (22%)
IG_like 159..238 CDD:214653 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.