DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and LOC100496188

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_031748713.1 Gene:LOC100496188 / 100496188 -ID:- Length:852 Species:Xenopus tropicalis


Alignment Length:334 Identity:71/334 - (21%)
Similarity:110/334 - (32%) Gaps:115/334 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ETTYPPPVFDFGMPRNITTRTGHTAAINC--RVDN--LGDK--SVSWIRKRDLHILTAGILTYTS 158
            |.|.||   |...|      .|..|.:.|  ||||  :..|  ::.|      |.....:|.|  
 Frog    28 EVTVPP---DQSSP------MGRDALLPCTFRVDNPPMNPKFLAILW------HFGDKEVLRY-- 75

  Fly   159 DERFKVVRTADSKD--------WTLHVKYAQPRDSGIYECQVNTEPKI-SMAFRLNVIVTPPDAK 214
            |.:.||.....|.|        .:|.:......|.|.|.|.|...|:. ....||.:...|   :
 Frog    76 DNKGKVSSPRVSIDERALLEGNASLSLSNVTVSDGGTYRCSVIYSPETQKKEIRLRIHALP---E 137

  Fly   215 AIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGP----IYWYRGPYILTPFVAHPNDAAIDLQR 275
            .::|..| |....|::  |.|       |..|..|    :.|.|...:|      ||.|...||:
 Frog   138 VVVAKRT-LVRNQGTA--LRC-------SVTDFYPQRITVTWLRNGKVL------PNSALGPLQQ 186

  Fly   276 ISMESTLAEKLQSRLRIANAQLLDTGNYTCM--------------------PTTAEAASVVVN-- 318
             :.:.|.  :|.|.|.:..:...||....|:                    |.:.:..|..:|  
 Frog   187 -NADGTF--RLNSTLTLTPSDTEDTPEIACLVQHESLPTPRRDSFRVQYGVPPSVQVYSAKINGR 248

  Fly   319 ---------------------VINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMVASSVVRWLIG 362
                                 ::|.:.|..::|||    .|..::....::..          .|
 Frog   249 PEQVLVCEASQFQPEPVRIQWLLNGKIPEDLKKSR----DGGFKTGSYYVINP----------TG 299

  Fly   363 GQRIGSNSC 371
            |.::|:.||
 Frog   300 GIQVGNISC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 27/107 (25%)
Ig 116..192 CDD:299845 22/89 (25%)
ig 220..306 CDD:278476 22/89 (25%)
IG_like 220..306 CDD:214653 22/89 (25%)
LOC100496188XP_031748713.1 V-set 30..133 CDD:400157 31/119 (26%)
Ig strand B 41..48 CDD:409353 1/6 (17%)
CDR1 49..58 CDD:409353 4/8 (50%)
FR2 60..70 CDD:409353 2/15 (13%)
Ig strand C 60..67 CDD:409353 1/12 (8%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 82..117 CDD:409353 7/34 (21%)
Ig strand D 85..91 CDD:409353 2/5 (40%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand A 136..143 CDD:409353 2/9 (22%)
Ig strand B 150..160 CDD:409353 4/18 (22%)
C1-set 153..220 CDD:400140 20/82 (24%)
Ig strand C 165..171 CDD:409353 1/5 (20%)
Ig strand C' 173..176 CDD:409353 0/2 (0%)
Ig strand D 180..187 CDD:409353 3/7 (43%)
Ig strand E 190..200 CDD:409353 4/11 (36%)
Ig strand F 210..217 CDD:409353 1/6 (17%)
Ig 234..315 CDD:416386 14/89 (16%)
Ig strand A 235..242 CDD:409353 1/6 (17%)
Ig strand B 251..258 CDD:409353 0/6 (0%)
Ig strand C 264..270 CDD:409353 0/5 (0%)
Ig strand C' 273..275 CDD:409353 0/1 (0%)
Ig strand E 287..295 CDD:409353 0/7 (0%)
Ig strand F 302..312 CDD:409353 3/7 (43%)
IgC1 <617..702 CDD:409354
Ig strand C 628..632 CDD:409354
Ig strand E 669..673 CDD:409354
Ig strand F 684..689 CDD:409354
Ig strand G 699..702 CDD:409354
Ig 701..804 CDD:416386
Ig strand B 712..729 CDD:409353
Ig strand C 734..741 CDD:409353
Ig strand C' 750..753 CDD:409353
Ig strand E 766..781 CDD:409353
Ig strand F 789..795 CDD:409353
Ig strand G 798..804 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.