DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and ntm

DIOPT Version :10

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:356 Identity:82/356 - (23%)
Similarity:136/356 - (38%) Gaps:130/356 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DFGMPR---NITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERF----KVVR 166
            |.|.|:   |:|.|.|.:|.:.|.|||...: |:|:.:        ..:.||.::::    :||.
 Frog    36 DAGFPKAMDNVTVRQGDSAILRCTVDNRVTR-VAWLNR--------STILYTGNDKWSIDPRVVL 91

  Fly   167 TADSK-DWTLHVKYAQPRDSGIYECQVNTE--PKISMAFRLNVIV-TPPDAKAIIAGPTDLYVKV 227
            .|::| .:::.::.....|.|.|.|.|.|:  ||.|   |:::|| .||   .|:...:.:.|..
 Frog    92 LANTKSQYSIEIQNVDIYDEGPYTCSVQTDNHPKTS---RVHLIVQVPP---RIVDISSSIAVNE 150

  Fly   228 GSSVTLTC------------------------------------------------HVKQP---- 240
            ||:|:|.|                                                .|..|    
 Frog   151 GSNVSLICIANGRPEPVVNWRYLSPKARGFVSEDEYLEITGITREQSGIYECSASNDVSAPDVRR 215

  Fly   241 ----------ATSAQDIGPIYWYRGPYIL---------TPFVAHPNDAAIDLQRISMESTLAEKL 286
                      ...||:||....:||  ||         ..|..:..|     :|:| :|....|:
 Frog   216 VKLTVNYPPYILDAQNIGAPLGHRG--ILQCEASAVPAADFFWYKED-----KRLS-DSWRGVKV 272

  Fly   287 QSRLRIANAQLL-----DTGNYTCMPTTA---EAASVVVNVI--NDESPAAMQKSRAIRT----- 336
            ::|..|:....|     |.||||||....   ..||:::..:  :..||...::|.|..|     
 Frog   273 ENRETISRVTFLNVSEQDYGNYTCMAKNLLGHSNASIILFELFQSTSSPLLQEESTAALTPLKGP 337

  Fly   337 -------SGSMRSS---RLVLLLAMVASSVV 357
                   |||.:.|   .|::||.::..|::
 Frog   338 GAVHDGNSGSTQCSFCAPLLILLLLLPFSLL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/102 (27%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 3/5 (60%)
FR2 137..151 CDD:409355 2/13 (15%)
Ig strand C 137..143 CDD:409355 2/5 (40%)
Ig strand C' 149..153 CDD:409355 0/3 (0%)
CDR2 153..162 CDD:409355 2/8 (25%)
Ig strand D 162..167 CDD:409355 2/8 (25%)
FR3 163..192 CDD:409355 8/29 (28%)
Ig strand E 172..178 CDD:409355 0/5 (0%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 30/161 (19%)
Ig strand B 231..235 CDD:409353 2/3 (67%)
Ig strand C 261..265 CDD:409353 1/3 (33%)
Ig strand E 289..292 CDD:409353 1/2 (50%)
Ig strand F 302..307 CDD:409353 4/4 (100%)
Ig strand G 310..313 CDD:409353 0/5 (0%)
ntmXP_004916061.1 Ig 45..133 CDD:472250 27/99 (27%)
Ig strand B 54..58 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 1/4 (25%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig strand G 126..129 CDD:409353 1/5 (20%)
Ig_3 136..206 CDD:464046 9/72 (13%)
ig 227..311 CDD:395002 26/91 (29%)
Ig strand B 240..244 CDD:409353 3/5 (60%)
Ig strand C 253..257 CDD:409353 1/3 (33%)
Ig strand E 279..283 CDD:409353 0/3 (0%)
Ig strand F 293..298 CDD:409353 4/4 (100%)

Return to query results.
Submit another query.