DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and iglon5

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:342 Identity:80/342 - (23%)
Similarity:122/342 - (35%) Gaps:102/342 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 TTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDK--SVSWIRKRDLHILTAGILTYTSDERFK 163
            |.:.||.      .|.|...|..|.::|.:|   ||  .|:|:.:.  :||.||...::.|.|.:
 Frog    27 TEFVPPA------DNYTVSQGDNATLSCLID---DKVTRVAWLNRS--NILYAGKDKWSIDSRVQ 80

  Fly   164 VVRTADSKDWTLHVKYAQPRDSGIYECQVNTE--PKISMAFRLNVIVTPPDAKAIIAGPTDLYVK 226
            :: |....::::.:.:....|.|:|.|...||  |..|..:   :||..| || |:...:.:.|.
 Frog    81 LL-TNTKSEYSIVITHVDVADEGLYTCSFQTEDKPHTSQVY---LIVQVP-AK-IVNISSSVTVN 139

  Fly   227 VGSSVTLTC-HVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSR- 289
            .||:|.|.| .|.:|..:      |.|.:                           |:|...|. 
 Frog   140 EGSNVNLQCLAVGKPEPT------ITWQQ---------------------------LSEGFSSEG 171

  Fly   290 --LRIANAQLLDTGNYTCMPTTAEAASV---------------VVNVINDESPAAMQKSRAIRTS 337
              |.|........|:|.|:  |:...||               :.:|.|.:||..          
 Frog   172 ELLEITEINRQQAGDYECV--TSNGVSVPDTKKVQITVNYPPYITDVKNAQSPVG---------- 224

  Fly   338 GSMRSSRLVLLLAMVASSVVRW-------LIGGQRIGSNSCHDS-----CSNLSTLHI-NY-CNL 388
               |.:.|......|..:...|       ||.|....|.....|     .||:::.|. || |..
 Frog   225 ---RPATLRCKAMAVPPAEFEWYKDEKRRLISGTEGLSIKTESSWSVIVFSNVTSRHYGNYTCLA 286

  Fly   389 RAKITSHLKEHRCLGPG 405
            ..|:.|.....|.|.||
 Frog   287 SNKLGSFNSSLRLLKPG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 25/96 (26%)
Ig 116..192 CDD:299845 20/77 (26%)
ig 220..306 CDD:278476 17/89 (19%)
IG_like 220..306 CDD:214653 17/89 (19%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 27/106 (25%)
IG_like 35..123 CDD:214653 25/96 (26%)
Ig 126..207 CDD:299845 25/117 (21%)
I-set 128..207 CDD:254352 23/114 (20%)
I-set 210..299 CDD:254352 21/101 (21%)
Ig 227..298 CDD:143165 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.