DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and cd4-2.2

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001352989.1 Gene:cd4-2.2 / 100334281 ZFINID:ZDB-GENE-100922-127 Length:515 Species:Danio rerio


Alignment Length:169 Identity:39/169 - (23%)
Similarity:63/169 - (37%) Gaps:61/169 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 TADSKDW---TLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVG 228
            |||..:.   ||:|...:|||||:|.|     .:....:.|:|:              .::||.|
Zfish    90 TADKVNLYGDTLNVPRLEPRDSGVYSC-----TQS
GKQYTLHVV--------------SVFVKPG 135

  Fly   229 ------SSVTLTCHVK-QPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDL--QRISMESTLAE 284
                  |.|.|.|::: .|.|..:      |.|          .|||...|.  |:|:::|..:.
Zfish   136 PVLIQSSDVELHCNIEGDPNTEVE------WLR----------PPNDQVHDAKHQKINLKSVSSS 184

  Fly   285 KLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDE 323
                          |.|.:||.....:.:..:..|.|.:
Zfish   185 --------------DEGKWTCKVEDLKLSVTLTVVANHQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 14/41 (34%)
Ig 116..192 CDD:299845 13/27 (48%)
ig 220..306 CDD:278476 21/94 (22%)
IG_like 220..306 CDD:214653 21/94 (22%)
cd4-2.2NP_001352989.1 IG 45..119 CDD:214652 13/33 (39%)
I-set 133..204 CDD:333254 21/100 (21%)
IG 212..317 CDD:214652
IG_like 345..416 CDD:214653
IG_like 426..501 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.