DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and LOC100329818

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_002667608.3 Gene:LOC100329818 / 100329818 -ID:- Length:414 Species:Danio rerio


Alignment Length:254 Identity:55/254 - (21%)
Similarity:99/254 - (38%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 DLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVT 209
            ||.....|:.....|.:|:.....||:..:|.:|.::..|:|:|:.|:|...:....|.:.||  
Zfish    65 DLSFNCTGVQCKDGDGKFRNRLILDSQTGSLTIKDSRITDTGVYKLQINESRQTEKIFIVTVI-- 127

  Fly   210 PPDAKAIIAG-------PTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPN 267
                     |       ...::|..|.||||...|:   |:.|:  .|.||.....:........
Zfish   128 ---------GFFHFGSHGEPVFVVKGDSVTLHSGVE---TNQQE--KIRWYFNNTRIAQITGDFT 178

  Fly   268 DAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVV-VNVINDES------- 324
            :...|:|  ..|..  |:.::||::.:    .|||.|.|..|...:.|. :.:|:::|       
Zfish   179 EICTDVQ--CNEGN--ERFRNRLKLDH----QTGNLTIMNITNTDSGVFRLRIISNDSISEKIFI 235

  Fly   325 ------PAAMQKSRAIRTSGSMRSSRLVLLLAMVASSVVRWLIGGQRIGSNSCHDSCSN 377
                  |....:.:::|...|:   .....|....|.|:.......||...:.:.:||:
Zfish   236 VAVFDIPGVEMRRKSVRKGESV---TFETCLVNSQSYVMTLYFNNTRITERTPNKTCSD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 15/60 (25%)
Ig 116..192 CDD:299845 12/46 (26%)
ig 220..306 CDD:278476 22/85 (26%)
IG_like 220..306 CDD:214653 22/85 (26%)
LOC100329818XP_002667608.3 I-set 26..126 CDD:254352 15/60 (25%)
Ig <80..113 CDD:299845 9/32 (28%)
Ig 144..231 CDD:299845 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.