DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr5

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001135740.1 Gene:nitr5 / 100216319 ZFINID:ZDB-GENE-020225-40 Length:337 Species:Danio rerio


Alignment Length:180 Identity:39/180 - (21%)
Similarity:65/180 - (36%) Gaps:47/180 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ETTY-----PPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRK---RDLHILTAGILTY 156
            ||.|     |..|..|        :.|.||.:.|.:.|.......|.::   .:..::.:.||..
Zfish    17 ETVYGNIIQPDTVVSF--------QEGETAVLRCFITNSQMSMTLWYKQVTGEEPRLIASSILRS 73

  Fly   157 T--------SDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDA 213
            :        ....|:|:|  |:..:.|.:..|...|||.|.|..:..         |||......
Zfish    74 SEIQFHNEFDSSHFEVLR--DTGGFNLKIVNAVQSDSGTYYCATSFS---------NVIEFGNGT 127

  Fly   214 KAIIAG-----PTDLYV----KVGSSVT-LTCHVKQPATSAQDIGPIYWY 253
            :.::.|     ||.|.:    :|.|:.. |.|.|:......:.  .:||:
Zfish   128 RLVVKGTNLNKPTYLQLHELEQVESAKNPLLCSVQNQLVRNEH--RLYWF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 19/103 (18%)
Ig 116..192 CDD:299845 19/86 (22%)
ig 220..306 CDD:278476 10/39 (26%)
IG_like 220..306 CDD:214653 10/39 (26%)
nitr5NP_001135740.1 Ig 23..132 CDD:299845 25/127 (20%)
IG_like 29..131 CDD:214653 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.