DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and nitr13

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001121856.1 Gene:nitr13 / 100148777 ZFINID:ZDB-GENE-070108-2 Length:350 Species:Danio rerio


Alignment Length:335 Identity:65/335 - (19%)
Similarity:110/335 - (32%) Gaps:76/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRT- 167
            |.||....:..|:|.|        |.:.......::|.::...|...|..:|.      |:.:| 
Zfish    25 PDPVMMASVGENVTLR--------CIILQEHSDPITWYKQTAGHQPLAVAMTQ------KLAQTP 75

  Fly   168 --------------ADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAK---- 214
                          .:|:...|.:......|...|.|...   |....|.....:....:|    
Zfish    76 VFFNNFQPSHFSIEVESETCNLKIYNVTSSDEATYYCGWR---KYETYFGRGTYLALKGSKNNQH 137

  Fly   215 ----AIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRG-----PYILTPFVAHPNDAA 270
                :::..|:...|:.|.::||.|.|.. ..|.:|| .::|:|.     |   .|.:.:.|:  
Zfish   138 KSKVSVVQHPSSHSVRSGVALTLICSVLS-ERSTEDI-KMFWFRSDSGDKP---VPEILYTNN-- 195

  Fly   271 IDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVV---NVINDESPAAMQKSR 332
               |.:..||.........|.|.....:|||.|.|  ..|....::.   ..||...|.    ..
Zfish   196 ---QSLQCESDFTHSCTFNLSINTVSQMDTGTYYC--AVATCGRILFGNGTKINMVEPV----DH 251

  Fly   333 AIRTSGSMRSSRLVLLLAMVASSVVRWLIGGQR-------IGSNSCHDSCSNLSTLHINYCNLRA 390
            .:...|.:....:|:::|.:.|..::     :|       ..|...|.|.....|..:||..|..
Zfish   252 LLIILGVLLGLCVVVIIAQIISRHIK-----ERHYNDEGLHNSERQHPSNQEQDTGELNYAALNV 311

  Fly   391 KITSHLKEHR 400
            ....|.:.||
Zfish   312 IERKHRRVHR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 17/107 (16%)
Ig 116..192 CDD:299845 14/90 (16%)
ig 220..306 CDD:278476 24/90 (27%)
IG_like 220..306 CDD:214653 24/90 (27%)
nitr13NP_001121856.1 IG_like 27..>112 CDD:214653 16/98 (16%)
IgV 29..125 CDD:143167 17/112 (15%)
Ig 143..242 CDD:299845 26/110 (24%)
IG_like 147..229 CDD:214653 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.