DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and lsamp

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:336 Identity:75/336 - (22%)
Similarity:137/336 - (40%) Gaps:69/336 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 NITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKY 179
            |||.|.|.||.:.|.|::...: |:|:.:..  |:.||...::.|.|.::.:.: ..:::|.::.
 Frog    40 NITVRQGDTAILRCFVEDRSSR-VAWLNRSG--IIFAGDDKWSLDPRVELEKRS-LLEYSLRIQK 100

  Fly   180 AQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHV---KQPA 241
            ....|.|.|.|.|.|:..........::..||....|.|   |:.|..||:|||.|..   .:|.
 Frog   101 VDVSDEGPYTCSVQTKQHTKTTQVYLIV
QVPPKISNISA---DITVNEGSNVTLMCIAYGRPEPM 162

  Fly   242 TSAQDIGPIYWYRGPYILTPFVA-------HPNDAAIDLQRISMESTLAEKLQSRLRIANA---Q 296
                    |.|..    |||...       ...:..:::|.|:.|.:...:.::...:|:|   |
 Frog   163 --------ITWRH----LTPTAGTSPARDFEGEEEFLEIQGITREQSGRYECKAANEVASADVKQ 215

  Fly   297 LLDTGNYTCMPTTA---EAASVVVNVINDESPAAM----------QKSRAIRTSGSMR----SSR 344
            :..|.||..:.|.:   ||.:....::..|:.|..          .:||.|.::..:.    .||
 Frog   216 VRVTVNYPPIITESKSNEATTGKQAILRCEASAVPAPDFEWYKDDTRSRRINSAQGLEIRNTGSR 280

  Fly   345 LVLLLAMVASSVVRWLIGGQRIGSNSCHDSCSNLSTLHIN-YCNLRAKIT---------SHLKEH 399
            .||::|.|..         :..|:.:| .:.:.|...:.: |...|...|         |::...
 Frog   281 SVLMVANVTE---------EHYGNYTC-VAANKLGITNTSLYLYKRVSPTKPMSASERGSNVHYQ 335

  Fly   400 RCLGPGSTVES 410
            ..:|||:.::|
 Frog   336 YKVGPGTPIDS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 23/90 (26%)
Ig 116..192 CDD:299845 20/75 (27%)
ig 220..306 CDD:278476 23/98 (23%)
IG_like 220..306 CDD:214653 23/98 (23%)
lsampXP_031751462.1 Ig 38..128 CDD:416386 23/91 (25%)
FR1 38..54 CDD:409353 7/13 (54%)
Ig strand A' 39..45 CDD:409353 3/4 (75%)
Ig strand B 47..55 CDD:409353 3/7 (43%)
CDR1 55..59 CDD:409353 1/3 (33%)
FR2 60..67 CDD:409353 2/7 (29%)
Ig strand C 60..66 CDD:409353 2/6 (33%)
CDR2 68..78 CDD:409353 3/11 (27%)
Ig strand C' 70..73 CDD:409353 1/2 (50%)
Ig strand C' 75..78 CDD:409353 0/2 (0%)
FR3 79..114 CDD:409353 7/35 (20%)
Ig strand D 83..90 CDD:409353 1/6 (17%)
Ig strand E 93..99 CDD:409353 1/5 (20%)
Ig strand F 106..114 CDD:409353 3/7 (43%)
CDR3 115..119 CDD:409353 1/3 (33%)
Ig strand G 119..128 CDD:409353 0/8 (0%)
FR4 121..128 CDD:409353 0/6 (0%)
Ig_3 131..206 CDD:404760 21/89 (24%)
Ig strand A' 138..143 CDD:409353 2/7 (29%)
Ig strand B 149..156 CDD:409353 4/6 (67%)
Ig strand C 162..167 CDD:409353 2/12 (17%)
Ig strand C' 173..175 CDD:409353 0/1 (0%)
Ig strand E 185..191 CDD:409353 0/5 (0%)
Ig strand F 198..205 CDD:409353 0/6 (0%)
Ig strand G 212..220 CDD:409353 1/7 (14%)
Ig_3 223..302 CDD:404760 16/88 (18%)
putative Ig strand A 224..230 CDD:409353 1/5 (20%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 2/3 (67%)
Ig strand F 295..300 CDD:409353 1/5 (20%)
Ig strand G 308..311 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.