DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and si:dkey-182g1.2

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_003201044.1 Gene:si:dkey-182g1.2 / 100005482 ZFINID:ZDB-GENE-060503-619 Length:268 Species:Danio rerio


Alignment Length:223 Identity:51/223 - (22%)
Similarity:82/223 - (36%) Gaps:59/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSW---IRKRDLHILTAGILTYTSDER 161
            |.|...|||                ..:|..:...|..|.|   .|.....:..:.:|..|.|..
Zfish    29 EVTEGDPVF----------------LDSCVTEIQKDDKVEWKFGSRVIATIVSNSALLYDTDDGI 77

  Fly   162 FKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISM---AFRLNVIVTPPDAKAIIAGPTDL 223
            |......:.|...|.::..:|:.||:||.:: |....:|   .||:.|:    ||.     ||::
Zfish    78 FAGKLQVNDKTGDLIIRNPRPKHSGVYEVKI-TSVNSAMPCKTFRVAVL----DAM-----PTEV 132

  Fly   224 YVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDL--QRISMESTLAEKL 286
            .||||          :|.....:|..|:.|.    :..::......||..  ::||...|..||.
Zfish   133 SVKVG----------EPVILQHNISDIHMYD----VIEWMFEDGKTAIARINKQISKNPTYGEKN 183

  Fly   287 Q-----------SRLRIANAQLLDTGNY 303
            :           ..|.||:::..|:|.|
Zfish   184 EKFKGRLALDQTGYLTIADSKTTDSGLY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 20/98 (20%)
Ig 116..192 CDD:299845 16/78 (21%)
ig 220..306 CDD:278476 23/97 (24%)
IG_like 220..306 CDD:214653 23/97 (24%)
si:dkey-182g1.2XP_003201044.1 Ig 31..113 CDD:299845 21/98 (21%)
IG_like 129..230 CDD:214653 23/97 (24%)
Ig 136..219 CDD:299845 19/90 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.