Sequence 1: | NP_001014480.4 | Gene: | dpr2 / 3346227 | FlyBaseID: | FBgn0261871 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003201044.1 | Gene: | si:dkey-182g1.2 / 100005482 | ZFINID: | ZDB-GENE-060503-619 | Length: | 268 | Species: | Danio rerio |
Alignment Length: | 223 | Identity: | 51/223 - (22%) |
---|---|---|---|
Similarity: | 82/223 - (36%) | Gaps: | 59/223 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 ETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSW---IRKRDLHILTAGILTYTSDER 161
Fly 162 FKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISM---AFRLNVIVTPPDAKAIIAGPTDL 223
Fly 224 YVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDL--QRISMESTLAEKL 286
Fly 287 Q-----------SRLRIANAQLLDTGNY 303 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr2 | NP_001014480.4 | IG_like | 113..206 | CDD:214653 | 20/98 (20%) |
Ig | 116..192 | CDD:299845 | 16/78 (21%) | ||
ig | 220..306 | CDD:278476 | 23/97 (24%) | ||
IG_like | 220..306 | CDD:214653 | 23/97 (24%) | ||
si:dkey-182g1.2 | XP_003201044.1 | Ig | 31..113 | CDD:299845 | 21/98 (21%) |
IG_like | 129..230 | CDD:214653 | 23/97 (24%) | ||
Ig | 136..219 | CDD:299845 | 19/90 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |