DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and zgc:172133

DIOPT Version :9

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001121763.1 Gene:zgc:172133 / 100003819 ZFINID:ZDB-GENE-080204-48 Length:396 Species:Danio rerio


Alignment Length:261 Identity:57/261 - (21%)
Similarity:96/261 - (36%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 NITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTY--------TSDERFKVVRTADSK 171
            :::...|.:..:...|.......::|...:.   ..|.|:.|        |..:||:.....||:
Zfish   129 SVSVMEGDSVTLCTGVQTNQSNRINWYFNKG---RIAEIIGYRRKVCADDTCPQRFRDRLKLDSQ 190

  Fly   172 DWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTD-----LYVKVGSSV 231
            ..:|.:......|||:|........||   ||:          ||:...|:     ..|..|.|:
Zfish   191 IGSLTIMKVSTEDSGLYT
LLHRGREKI---FRV----------AILDSSTEENWKQKSVTEGESI 242

  Fly   232 TLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSR-----LR 291
            ||...:|   |:..|:  :.||.|..:|.......:....|.|....|....::|:..     |.
Zfish   243 TLDTPIK---TTPNDV--LKWYFGEILLAEITGDESQICEDAQCKDGEDEFRDRLKVNHSSGFLT 302

  Fly   292 IANAQLLDTGNYTCMPTT-----AEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAM 351
            |.|::..|:|.||.:..:     :.:.||:|..          ...::.|...|....|||||.:
Zfish   303 IMNSRKADSGEYTLLINSTSFYISRSFSVIVTF----------SGISLSTGIGMCVGVLVLLLLL 357

  Fly   352 V 352
            |
Zfish   358 V 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 20/98 (20%)
Ig 116..192 CDD:299845 16/83 (19%)
ig 220..306 CDD:278476 24/95 (25%)
IG_like 220..306 CDD:214653 24/95 (25%)
zgc:172133NP_001121763.1 IG_like 23..118 CDD:214653
Ig 28..117 CDD:299845
Ig 128..208 CDD:299845 15/81 (19%)
IG_like 128..>208 CDD:214653 15/81 (19%)
IG_like 235..333 CDD:214653 25/102 (25%)
Ig 239..333 CDD:299845 24/98 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.