DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr2 and dscaml1

DIOPT Version :10

Sequence 1:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_005157551.2 Gene:dscaml1 / 100002762 ZFINID:ZDB-GENE-110601-1 Length:2089 Species:Danio rerio


Alignment Length:301 Identity:73/301 - (24%)
Similarity:114/301 - (37%) Gaps:73/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WTMQQQHLSPAIQQHPAVKSLSH------LVDGNDNLLPMVSAPSSIDNDYVYIASVNRKFPQFG 84
            ||:..:         |..:..:|      |.||:......|:.|...|......|:.|       
Zfish   441 WTLDDE---------PVARDSAHRASQYTLSDGSTVSHVNVTNPQIRDGGVYRCAARN------- 489

  Fly    85 NSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHIL 149
                ....||.|.......||.:   ...||||...|....|||||......|:.|.:.      
Zfish   490 ----SAGSAEYQARINVRGPPSI---RAMRNITAVAGRNTFINCRVIGYPYYSIKWYKD------ 541

  Fly   150 TAGILTYTSDERFKVVRTADSKDWTLHVKYAQP-RDSGIYECQVNTEPKISMAFRLNVIV-TPPD 212
              |:|  ..|...:||    .::.||.:...|. .|.|.|.|.|..:|::|::..:.|.| .||.
Zfish   542 --GML--LPDNHRQVV----YENGTLKLSDVQKGMDEGAYLCSVLIQPQLSISQTVYVTVKVPPL 598

  Fly   213 AKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGP--IYWYR-GPYILTPFVAHPNDAAIDLQ 274
            .:.....||    .:|..:.:.|.|     |:.|: |  |.|.: |..|::      ..|.:.::
Zfish   599 IQPFDFPPT----SIGKLMYIACVV-----SSGDM-PIRITWRKDGQEIVS------GTAGVTIE 647

  Fly   275 RISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASV 315
                    .::..|.|:|:...|...|||||:.:. :||:|
Zfish   648 --------TKEFMSSLQISKVSLKHNGNYTCIASN-DAATV 679

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 27/93 (29%)
Ig strand A' 116..118 CDD:409355 1/1 (100%)
Ig strand B 122..130 CDD:409355 3/7 (43%)
CDR1 130..136 CDD:409355 1/5 (20%)
FR2 137..151 CDD:409355 2/13 (15%)
Ig strand C 137..143 CDD:409355 2/5 (40%)
Ig strand C' 149..153 CDD:409355 0/3 (0%)
CDR2 153..162 CDD:409355 2/8 (25%)
Ig strand D 162..167 CDD:409355 2/4 (50%)
FR3 163..192 CDD:409355 9/29 (31%)
Ig strand E 172..178 CDD:409355 2/5 (40%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 21/88 (24%)
Ig strand B 231..235 CDD:409353 0/3 (0%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 1/2 (50%)
Ig strand F 302..307 CDD:409353 4/4 (100%)
Ig strand G 310..313 CDD:409353 0/2 (0%)
dscaml1XP_005157551.2 Ig 27..122 CDD:472250
Ig strand B 43..47 CDD:409353
Ig strand C 56..60 CDD:409353
Ig strand E 80..84 CDD:409353
Ig strand F 100..105 CDD:409353
Ig strand G 113..117 CDD:409353
I-set 233..311 CDD:400151
Ig strand B 243..247 CDD:409353
Ig strand C 256..260 CDD:409353
Ig strand F 291..296 CDD:409353
Ig 314..396 CDD:472250
Ig strand B 332..336 CDD:409353
Ig strand C 345..349 CDD:409353
Ig strand E 369..373 CDD:409353
Ig strand F 383..388 CDD:409353
Ig 407..502 CDD:472250 15/80 (19%)
Ig strand B 425..429 CDD:409353