DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk13 and ppk30

DIOPT Version :9

Sequence 1:NP_001014495.1 Gene:ppk13 / 3346226 FlyBaseID:FBgn0053508 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster


Alignment Length:331 Identity:83/331 - (25%)
Similarity:143/331 - (43%) Gaps:58/331 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NFSYYAEL-------------VRSSCVDSISNCEWNNKPFECCKYFHRMETELGICYAINSM-QA 191
            ||:.::||             ::.:|....:.|:|..|...||..|...:|..|..:..||: .:
  Fly   127 NFTEFSELENWNAQSWGIYQALQMNCQHFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFNSLVSS 191

  Fly   192 GKPKMPKLNMYSNRGSGPGALKMELHTEATVFILGTEEV----PT-LVTPKTDF----LVVGPYI 247
            |:.:....:: ::.||..| |.:::..:..::.|.|..|    || |:....|:    .:|.| :
  Fly   192 GRDETWPWSV-ASCGSYSG-LNVKIKRQQGLYTLNTMGVIVHEPTQLLGMSIDYSSEDRIVVP-V 253

  Fly   248 SFVRYISKRDIENDEEIRQTSVHQRNCRFADENILDVHKFYSYSACTVQCRKDRQMELCNCSSHL 312
            ..:.:.::.|      :|...|..|.|.|  ||.:...|  |.|.|..:|..:..:..||||..|
  Fly   254 EPLHFTAELD------VRARPVQMRRCYF--ENEIPTGK--SRSECIYKCHVNYIISKCNCSLEL 308

  Fly   313 -------------SPNSPDWQLCNMEGLECLNRNYEDL---SVIIAKWSKLRGRKGLVCDCLPSC 361
                         :..|...::|.::.|.|.|::...|   |.||.: |:......:.|.|.|.|
  Fly   309 PVKATQDEDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIEE-SRDNVFSTVDCGCFPQC 372

  Fly   362 TEVDI-TTVYDSKENMAGSQNAISRIEVGL-IELPTERYKRNLVRGKL-DLVVSIGGTTGLFVGA 423
            ..... |:.|  .|.|:...|..:.||:.: .:..|....|:::|..| ||:||.||..||.:|.
  Fly   373 GHTQYHTSTY--TEKMSAHTNLAAAIEIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGI 435

  Fly   424 SLLSFV 429
            |:|..:
  Fly   436 SVLGCI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk13NP_001014495.1 ASC 10..434 CDD:279230 83/331 (25%)
ppk30NP_001263076.1 ASC 47..446 CDD:279230 83/331 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.