DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk13 and Asic2

DIOPT Version :9

Sequence 1:NP_001014495.1 Gene:ppk13 / 3346226 FlyBaseID:FBgn0053508 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_037024.2 Gene:Asic2 / 25364 RGDID:2017 Length:563 Species:Rattus norvegicus


Alignment Length:496 Identity:119/496 - (23%)
Similarity:186/496 - (37%) Gaps:122/496 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LKNSTLHGARFI----VDKDASWIERIFWVIC------LVASWYASWLLIKASLSAFENNAISFV 65
            |..:.|||.|.:    .....|:..|..||:.      |:.||.::.||...|..:...      
  Rat    61 LSRTKLHGLRHMCAGRTAAGGSFQRRALWVLAFCTSLGLLLSWSSNRLLYWLSFPSHTR------ 119

  Fly    66 VESSFRDWNTN--FPAIIVCESKNMDRIQEVAE-QLWGADH-------DFTLEEVLSEIAFFRGE 120
               ..|:|:..  |||:.|| :.|..|...::: .|:.|.|       :.|...::||:  .||:
  Rat   120 ---VHREWSRQLPFPAVTVC-NNNPLRFPRLSKGDLYYAGHWLGLLLPNRTARPLVSEL--LRGD 178

  Fly   121 -----------SYHTVHECSGEEVTASCFYSNFSYYAELVRSSCVDSISNCEWNNKPFECC--KY 172
                       .:.........|..::.|.....:..|       |.:.:|::..   |.|  ..
  Rat   179 EPRRQWFRKLADFRLFLPPRHFEGISAAFMDRLGHQLE-------DMLLSCKYRG---ELCGPHN 233

  Fly   173 FHRMETELGICYAINSMQAGKPKMPKLNMYSNRGSGPGALKMEL------------HTEATVFIL 225
            |..:.|:.|.||..||.:.|||.:..:    ..|:|.| |::.|            .||.|.|..
  Rat   234 FSSVFTKYGKCYMFNSGEDGKPLLTTV----KGGTGNG-LEIMLDIQQDEYLPIWGETEETTFEA 293

  Fly   226 G------TEEVPTLVTPKTDFLVVGPYISFVRYISKRDIENDEEIRQTSVHQ--RNCRFADENIL 282
            |      ::..|..: .:..|.|...:.:||.         .:|.|.|.:..  ..|| :.|..|
  Rat   294 GVKVQIHSQSEPPFI-QELGFGVAPGFQTFVA---------TQEQRLTYLPPPWGECR-SSEMGL 347

  Fly   283 DVHKFYSYSACTVQCRKDRQMELCNCSS-HLSPNSPDWQLCNME----------GL-------EC 329
            |....||.:||.:.|.....:|.|||.. |:..::|   .|..|          ||       .|
  Rat   348 DFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAP---FCTPEQHKECAEPALGLLAEKDSNYC 409

  Fly   330 LNRNYEDLSVIIAKWSKLRGRKGLVCDCLPSCTEVDITTVYDSKENMAGSQNAISRIEVGLIELP 394
            |.|...:|:         |..|.|....:||.|.........:|.....|:| |..:::....|.
  Rat   410 LCRTPCNLT---------RYNKELSMVKIPSKTSAKYLEKKFNKSEKYISEN-ILVLDIFFEALN 464

  Fly   395 TERYKRNLVRGKLDLVVSIGGTTGLFVGASLLSFVEIFYYI 435
            .|..::........|:..|||..|||:|||||:.:|:|.||
  Rat   465 YETIEQKKAYEVAALLGDIGGQMGLFIGASLLTILELFDYI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk13NP_001014495.1 ASC 10..434 CDD:279230 117/493 (24%)
Asic2NP_037024.2 ENaC 64..557 CDD:273304 118/493 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X60
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.