DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk13 and egas-1

DIOPT Version :9

Sequence 1:NP_001014495.1 Gene:ppk13 / 3346226 FlyBaseID:FBgn0053508 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001359624.1 Gene:egas-1 / 180219 WormBaseID:WBGene00013486 Length:922 Species:Caenorhabditis elegans


Alignment Length:302 Identity:56/302 - (18%)
Similarity:111/302 - (36%) Gaps:61/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 EWNNKPFECCKYFHRMETELGICYAINSMQAGKPKMPKLNMYSNRGSG-PGALKMELHTEATVFI 224
            :||             :..||.|:..|...       :...|..|.|| .|.::..:.|....:.
 Worm   642 KWN-------------DVVLGNCFTFNHRD-------RNFTYRLRSSGRHGGIQAFMKTRQDEYA 686

  Fly   225 --LGTEEVPTLVTPKTDFLVVGPYISFVRYISKRDIENDEEIRQTSVHQRNCRFAD--ENILDVH 285
              ..|..:...:..:.|::    :...|||.::.:.::...|..|...:...|:..  :...:|.
 Worm   687 PWYDTAAINVFIHNRDDYV----FSESVRYNAQPNAQSTMNIFMTRYTRLGGRYGKCVKKPSEVK 747

  Fly   286 KFY---SYS--ACTVQCRKDRQMELCNCSSHLSPNSP-DWQLCNMEGLECLNRNYEDLSVIIAKW 344
            .:|   :|:  .|...|.:||..:.|||.....|.:| :...|.:....|         |.:|..
 Worm   748 NYYYPGAYTTDGCLRTCYQDRMKQECNCMDPRYPQAPGNVTSCQLSERSC---------VTVASE 803

  Fly   345 SKLRGRKGLVCDCLPSCTEVDITTVYDSKEN------MAGSQNAIS----------RIEVGLIEL 393
            :.....|...|.|...|:..:.:..: ||.|      :.|..:.:|          .:.:.|.:|
 Worm   804 AAGDPSKWWDCVCPLPCSNQEYSVTW-SKANFVNLPIICGKSSDVSTCKAHYIDQLMVSIVLPQL 867

  Fly   394 PTERYKRNLVRGKLDLVVSIGGTTGLFVGASLLSFVEIFYYI 435
            ..:.|..|........:..:||..|:.:|.:|::|:|:.:.:
 Worm   868 DFKIYAENPAMDFNKFLSQLGGQLGVLMGINLVTFIEVVFLL 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk13NP_001014495.1 ASC 10..434 CDD:279230 56/299 (19%)
egas-1NP_001359624.1 deg-1 <595..908 CDD:273309 56/299 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.