DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk13 and del-6

DIOPT Version :9

Sequence 1:NP_001014495.1 Gene:ppk13 / 3346226 FlyBaseID:FBgn0053508 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_741622.2 Gene:del-6 / 179474 WormBaseID:WBGene00011891 Length:577 Species:Caenorhabditis elegans


Alignment Length:215 Identity:42/215 - (19%)
Similarity:81/215 - (37%) Gaps:62/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 IENDEEIRQTSVHQRNCRFADENILDVHKFYSYSACTVQCRKDRQMELCNCS----SHLSPNSP- 317
            :||||:       ...||..::.  :..:|    .|..:||.:...:.|:|:    |:|:.... 
 Worm   329 LENDEQ-------GTRCRDVEDG--EDSEF----NCRSRCRMEMIRDACHCTPLSLSYLAKKEDM 380

  Fly   318 ------DWQLC-------NMEGLECLNRNYEDLSVIIAKWSKLRGRKGLVCDCLPSCTEVDITTV 369
                  |:..|       |....||.|:                        |.|.|.::.....
 Worm   381 EIFPLCDYTQCTVDVQKGNYSDTECANK------------------------CFPDCRQIRFEVD 421

  Fly   370 YDSKENMAGSQNAISRIEVGLIELPT--ERYKRNLVRGKLDLVVSIGGTTGLFVGASLLSFVEIF 432
            :..|..|......:..:..|..|..|  :::|.:..    ..:.::||:.|:::|.|:||.:::.
 Worm   422 HSVKGRMLRPDLTLVELSWGPFEYLTMEQQWKYSAT----SFIAALGGSIGMWLGLSILSLIQLV 482

  Fly   433 YYITIRPYTTYINEKRRLKR 452
            .| :...:|..|..:|.||:
 Worm   483 TY-SYTYFTKKIVNERILKK 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk13NP_001014495.1 ASC 10..434 CDD:279230 36/195 (18%)
del-6NP_741622.2 ASC <347..484 CDD:295594 30/168 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.