DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk13 and unc-8

DIOPT Version :9

Sequence 1:NP_001014495.1 Gene:ppk13 / 3346226 FlyBaseID:FBgn0053508 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001294293.1 Gene:unc-8 / 177494 WormBaseID:WBGene00006748 Length:778 Species:Caenorhabditis elegans


Alignment Length:444 Identity:90/444 - (20%)
Similarity:159/444 - (35%) Gaps:111/444 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ESSFRDWNTNF---------PAIIVCESKNMDRIQEVAEQLWGADHDFTLEEVLSEIAFFRGESY 122
            :...|.||.|.         |...:.|::....:.::.:.  ||....|.|.::..:|....|:.
 Worm   348 KDEIRWWNPNNYTVYSVTEPPTTEITETEEAFGLSDLKDA--GAITTQTKENLIFLVAALPRETR 410

  Fly   123 HTVHECSGEEVTASCFYSNFSYYAELVRSSCVDSISNCEWNNKPFECCKYFH-RMETELGICYAI 186
            .                 |.||       :..:.:..|.:|:|.....:.|. .::.|.|.||..
 Worm   411 R-----------------NLSY-------TLNEFVLRCSFNSKDCSMERDFKLHVDPEYGNCYTF 451

  Fly   187 NSMQAGKPKMPKLNMYSNRGSGP-GALKMELHTEATVFILGTEEVPT-LVTPKTD---FLVVGPY 246
            |...:.:.|        |..:|| ..|::.|:...:.::..||.... ||..:.|   |.....|
 Worm   452 NFNDSVELK--------NSRAGPMYGLRLLLNVHQSDYMPTTEAAGVRLVVHEQDQEPFPDTFGY 508

  Fly   247 ISFVRYISKRDIENDEEIRQTSVHQRNCRFADENILDVH-KFYSYSACTVQCRKDRQMELCNCSS 310
            .:...:||...::. :|:.:.|....||......:..:: :.||...|...|.:.:.:|:|.|..
 Worm   509 SAPTGFISSFGLKT-KELHRLSAPWGNCSDTFRPVPYIYNEHYSPEGCHRNCFQLKVLEICGCGD 572

  Fly   311 HLSP-NSPDWQLCNMEG---LECLNRNYEDLSVIIAKWSKLRGRKGL--VCDCLPSCTEVDITTV 369
            ...| .|.:.:.||.:.   .:||:....|..          |...|  .|:|...|.|....|.
 Worm   573 PRFPLPSEEHRHCNAKSKIDRQCLSNLTSDSG----------GYHHLHEQCECRQPCHEKVFETA 627

  Fly   370 YDSKENMAGSQN--------AISRIEVGLIELPTERYKRNLVRGKL------------------- 407
            |.:  :...|||        |:|.| ....|..||.|::|....::                   
 Worm   628 YSA--SAWPSQNFKIGTDCPAVSDI-FNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLV 689

  Fly   408 DLVVSIGGTTGLFVGASLLSFVE----------IFYYITIRPYTTYINEKRRLK 451
            :|....||..||::|.|:::|.|          :.|:..|    .|:.:|.:.|
 Worm   690 NLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYFKGI----VYVQKKMQGK 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk13NP_001014495.1 ASC 10..434 CDD:279230 85/425 (20%)
unc-8NP_001294293.1 ASC 100..719 CDD:295594 85/418 (20%)
deg-1 107..716 CDD:273309 85/415 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.