DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk13 and LOC103910008

DIOPT Version :9

Sequence 1:NP_001014495.1 Gene:ppk13 / 3346226 FlyBaseID:FBgn0053508 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_009296668.1 Gene:LOC103910008 / 103910008 -ID:- Length:99 Species:Danio rerio


Alignment Length:41 Identity:18/41 - (43%)
Similarity:26/41 - (63%) Gaps:7/41 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 GLFVGASLLSFVEIFYYITIRPYTTYINEKRRLKRLIIPKR 458
            |||:|||:|:.:||..|:       |...|.||:||:.|:|
Zfish     2 GLFIGASVLTILEILDYV-------YEVIKHRLERLLRPQR 35

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk13NP_001014495.1 ASC 10..434 CDD:279230 9/15 (60%)
LOC103910008XP_009296668.1 ASC <1..32 CDD:295594 16/36 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.