DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and pkdc

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:369 Identity:66/369 - (17%)
Similarity:125/369 - (33%) Gaps:105/369 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GYLGDYYALTLRYCHEEEEIIREIELFVKAMPQQ-------SAELS---KESIFQKESWLYDTLI 90
            || |:...:.|..|.....:::.:     ..||.       :.::|   |...:|.|::.|    
Zfish    30 GY-GEIIRVHLEGCDRPSVVVKHV-----MFPQNQKHPGGWNTDISHQRKVRSYQVETYWY---- 84

  Fly    91 KKLQALSNVKWSPNC---------VYSRKDLMVLENIKLKGFTSAGSAELNEVFVKPLIKSIAAF 146
                  .|...:.||         .:..:.|:|||::.:.|| ......:|:..:|..:..||.|
Zfish    85 ------QNYTTNENCRVPLCLAAKSFGEEQLIVLEDLDVAGF-PVRKTYVNDAEIKACLSWIANF 142

  Fly   147 HSASLVYEHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFIGDKL 211
            |:..|....:....|| ||..  ||...:...|.....|.|....:.|:..              
Zfish   143 HALFLDVTPEGLWPIG-TYWH--LETRPEELEAMSDQKLKAAAGEIDSILN-------------- 190

  Fly   212 MGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPENSGPALLIDFQTCRYAPPASDLNFCLYMN 276
                         :.:::.:: |.|....|..|..:....| .:|||   |......:...:|..
Zfish   191 -------------NCRFKTIV-HGDAKLANFCFSKDGLQVA-SVDFQ---YVGGGCGMKDVIYFL 237

  Fly   277 LSSSKRKQMEKQG---IDLYHTYLLQNLSDLGLEELVISKSELLESYEEFR-LFGVVYRAVAATV 337
            .|....::.||:.   :|.|.:.|.::|.         .|.:..|..:|:| :|.          
Zfish   238 GSCMDERECEKKAPGLLDYYFSELRKSLE---------KKVDFAELEKEWRNMFA---------- 283

  Fly   338 VKVPTDFITNDFKYVDRSKVILSYMKTNPEFATYMEECCVDVME 381
                       |.:.|..:.:|.:|..:.:...|.:....:|::
Zfish   284 -----------FAWTDFHRFLLGWMPGHHKINKYSKRLTQEVLK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 50/263 (19%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 40/215 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.