DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG10562

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster


Alignment Length:371 Identity:92/371 - (24%)
Similarity:166/371 - (44%) Gaps:66/371 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ESAVRVKLLDYHLVRDLSA-IG-YLGDYYALTLRYCHEEEEI----IREIELFVKAMPQQ----S 70
            |..::..:..|..:::..| || ..|:.||..:.....|.|:    .:.:...|| :|.|    .
  Fly    16 EDLLKANVDGYSKIKNFKADIGSAAGENYATIMLRVKIEVELQDGKSKSVSYMVK-LPHQVEAIQ 79

  Fly    71 AELSKESIFQKESWLYDTLIKKLQA-----------------LSNVKWSPNCVYSRKDLMVLENI 118
            ..:.:.:||:.|..:|:.::.:|:|                 |.|.|         .|.:.||::
  Fly    80 EMMKRTNIFEIERTMYNEVVPELEALYKAVGVDITFGAKNYDLKNAK---------TDYVALEDL 135

  Fly   119 KLKGFTSAGSAE-LNEVFVKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVDSE----I 178
            .||||.:|...| |::...:.:::.::.:|:||.|     :......|...||:.....|    :
  Fly   136 GLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAV-----RVATKGPYPKILLQGFFKEESRPVM 195

  Fly   179 AWFTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGI----METIYEQAAPSKKYRNVLCHRDIWA 239
            :....|:.|  ..|:|.|.|:|:  :::: ||:..:    ::.|:|.|.......|||.|.|.|:
  Fly   196 SEMIKGMGA--NFVKSCATYEGH--EAYL-DKVKALQPVAIDKIFEFAKVEPTEFNVLNHGDSWS 255

  Fly   240 GNIFFPPENSG---PALLIDFQTCRYAPPASDLNFCLYMNLSSSK-RKQMEK--QGIDLYHTYLL 298
            .||.|..:..|   ...|:|:|..:|...|.||   ||..|||:| ..::.|  ..|.:||..|:
  Fly   256 NNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDL---LYFLLSSTKLEDKLAKFDYYIKIYHDNLV 317

  Fly   299 QNLSDLGLEELVISKSELLESYEEFRLFG-VVYRAVAATVVKVPTD 343
            ::|..|...:.:.|..::..:..::..|| .|...|.:.|:..|||
  Fly   318 EHLKILKYSKPIPSLRDIHLALFKYGYFGYTVATGVMSAVLLDPTD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 72/277 (26%)
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 78/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459698
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.